CAZyme Information: EJT51914.1

Basic Information

• Species: Trichosporon asahii
• Lineage: Basidiomycota; Tremellomycetes; ; Trichosporonaceae; Trichosporon; Trichosporon asahii
• CAZyme ID: EJT51914.1
• CAZy Family: GT33
• CAZyme Description: Ricin B-type lectin domain-containing protein [Source:UniProtKB/TrEMBL;Acc:J6F4H8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
173		18447.87	7.2191

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TasahiiCBS2479	8834	1186058	523	8311

• Gene Location: location=JH977542:110707-111268(+)

Full Sequence      

MLSLLAKLALLAVVATAASPPKPLPSGALTPKFVAQIHAAGSRRKCIHVAGNIENGTPLQ
VGDCVGGGFGNPPFEINGGLTEIRVAGSNYCVDVGNAPLNNGNQVKIWNCHGGYQQQFDY
TRDGRIRVHGQNICLDVTDGKLENGNPIQIYSCGDLDNDNQWFPAENVVQPRK

Enzyme Prediction     

No EC number prediction in EJT51914.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	80	162	6e-16	0.425531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	1.00e-17	81	162	3	82	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	2.23e-16	33	162	1	126	Ricin-type beta-trefoil lectin domain.
411519	lectin_2	4.99e-16	41	158	124	235	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
238092	RICIN	7.64e-15	36	163	2	122	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	6.89e-12	83	162	1	74	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW46144.1|CBM13	9.71e-10	34	126	33	126
AGV14186.1|CBM13	3.31e-09	36	126	35	126
AUB23598.1|CBM13	3.31e-09	36	126	35	126
AFR93997.1|CBM13	3.31e-09	36	126	35	126
QKV69899.1|CBM13|GH10	3.06e-07	63	124	339	395

PDB Hits     

EJT51914.1 has no PDB hit.

Swiss-Prot Hits     

EJT51914.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000318	0.999648	CS pos: 17-18. Pr: 0.9748

TMHMM  Annotations     

There is no transmembrane helices in EJT51914.1.