CAZyme Information: EJT50939.1

Basic Information

• Species: Trichosporon asahii
• Lineage: Basidiomycota; Tremellomycetes; ; Trichosporonaceae; Trichosporon; Trichosporon asahii
• CAZyme ID: EJT50939.1
• CAZy Family: GT22|GT22
• CAZyme Description: GPI mannosyltransferase 2 [Source:UniProtKB/TrEMBL;Acc:J6F1U7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482		52169.32	9.4187

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TasahiiCBS2479	8834	1186058	523	8311

• Gene Location: location=JH977550:783486-784934(+)

Full Sequence      

MTRTFAAPTATPGSPKSRHRSTDEYLLTAVTATSYIGTLLALNALSYLPRFDTSGSVFGR
WDSVHFFSVARNGYEYEQQVAFQPGWHALLHSGANAVGSIRQWLGIDPPLISKAGGGRGL
WVEGVTSTPDDIEIAAIAINLIARIAASLALYRLTCRLFNRKTAVAAGLLYAYPPSPAAM
LTYTEPAFAAAYFAGLLACSKRRWLGAALCFAAATSLRATGVFSAAVLAWALVFAPRRPA
SPDVKRSIPFTSYVCAALRDPGRTLIRAVIAVTLAGIVAAPFIVFNGYIWKIACPGREWC
SKSLPLAYTAVQKIYWDIGLFHYWTPEQIPNLIIALPVLIPTLAGIWAYFSGKTLSLHSE
AAHRADSLASIQASTTYAISSAHNVRASAEVKEVKGDVQDETTGDEVARGPLLDAVYALS
LFLALTLLFTSHTQIALRLAVTDPTLWWTLAANAGMRKAWIWWCFLWAAVGLALWSGHYP
PA

Enzyme Prediction     

No EC number prediction in EJT50939.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	57	482	7.9e-76	0.8722358722358723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.49e-21	25	349	16	320	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.11e-10	150	363	133	331	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].
404170	PMT_2	2.57e-04	148	258	36	152	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UOH80020.1|GT76	3.56e-64	27	482	7	420
EAL22094.1|GT76	1.49e-63	27	482	7	423
AAW42711.1|GT76	2.09e-63	27	482	7	423
AFR93820.1|GT76	2.71e-63	27	482	7	420
AUB23397.1|GT76	2.71e-63	27	482	7	420

PDB Hits     

EJT50939.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CP63|GPI18_CRYNB	2.65e-64	27	482	7	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GPI18 PE=3 SV=1
sp|P0CP62|GPI18_CRYNJ	3.71e-64	27	482	7	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=GPI18 PE=3 SV=1
sp|Q09712|GPI18_SCHPO	5.91e-26	60	355	127	380	GPI mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi18 PE=3 SV=2
sp|Q6C216|GPI18_YARLI	4.26e-19	61	482	49	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q5KR61|PIGV_RAT	6.66e-18	49	349	44	345	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000010	0.000012

TMHMM  Annotations     

Start	End
26	48
132	154
211	233
268	290
329	351
417	439
460	479