CAZyme Information: EJT50855.1

Basic Information

• Species: Trichosporon asahii
• Lineage: Basidiomycota; Tremellomycetes; ; Trichosporonaceae; Trichosporon; Trichosporon asahii
• CAZyme ID: EJT50855.1
• CAZy Family: GT21
• CAZyme Description: Glycoside hydrolase family 24 protein [Source:UniProtKB/TrEMBL;Acc:J4UH35]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		32262.72	8.9033

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TasahiiCBS2479	8834	1186058	523	8311

• Gene Location: location=JH977551:71943-72942(-)

Full Sequence      

MPEKGLARDARCYAVRGEELVGETADDGYLGSRKLTPVLLSAITSLALAVSALAAGPGPY
PVKETLHCRSSPSTSGKIVKDYPKGTKIKLSCYSRGQSIGGNTIWDKTTDGCFVADYYVT
TGTTNPVVAACSGGGGSVSPCPSINDAGIALIKEFEGFFKNPYKDPVGLWTVGYGHLCAN
GGKDSSCSGTGFKYPLTEATATELLKKDLPSYTSCFPKYLTSGAKLNKNQYAALTSFTFN
LGCGVLKDFAGRLNKGEDASTVFAQEFPKYVHAGGNVLQGLVRRRNAEVALAKKAGSTEA
WPKCAK

Enzyme Prediction     

No EC number prediction in EJT50855.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	144	288	2.9e-37	0.9927007299270073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381599	lyz_endolysin_autolysin	1.26e-50	148	291	1	134	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381620	lyz_P1	1.10e-29	143	291	1	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
226295	RrrD	1.46e-28	143	291	6	146	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
381619	endolysin_R21-like	3.26e-22	147	291	7	140	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
395766	Phage_lysozyme	3.25e-10	170	285	2	106	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ52746.1|GH24	7.37e-81	44	304	3	265
UKZ78548.1|GH24	7.37e-81	44	304	3	265
UNI22263.1|GH24	1.74e-80	47	304	8	270
QYS99898.1|GH24	9.13e-77	44	304	3	266
QKD50435.1|GH24	2.10e-73	42	304	4	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	2.76e-17	125	294	39	195	Chain A, Lysozyme [Acinetobacter baumannii]
6H9D_A	1.13e-09	144	291	6	145	Chain A, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]
1XJU_A	1.52e-07	145	288	3	146	Chain A, Lysozyme [Punavirus P1],1XJU_B Chain B, Lysozyme [Punavirus P1]
7M5I_A	3.13e-06	148	288	13	149	Chain A, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]
1XJT_A	3.48e-06	145	288	31	174	Chain A, Lysozyme [Punavirus P1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P11187|ENLYS_BPPH2	1.88e-14	144	291	3	141	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
sp|P07540|ENLYS_BPPZA	3.52e-14	144	291	3	141	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
sp|P51728|ENLYS_BPHC1	6.72e-13	144	291	35	182	SAR-endolysin OS=Haemophilus phage HP1 (strain HP1c1) OX=1289570 GN=lys PE=3 SV=1
sp|P62692|ENLYS_BPLC2	4.59e-12	144	298	3	142	Endolysin OS=Lactococcus phage c2 OX=31537 GN=L3 PE=3 SV=1
sp|P62693|ENLYS_BPPHV	4.59e-12	144	298	3	142	Endolysin OS=Lactococcus phage phivML3 OX=10746 GN=L3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.844209	0.155777

TMHMM  Annotations     

There is no transmembrane helices in EJT50855.1.