CAZyme Information: EJT50333.1

Basic Information

• Species: Trichosporon asahii
• Lineage: Basidiomycota; Tremellomycetes; ; Trichosporonaceae; Trichosporon; Trichosporon asahii
• CAZyme ID: EJT50333.1
• CAZy Family: GH88
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1041		116964.95	6.6979

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TasahiiCBS2479	8834	1186058	523	8311

• Gene Location: location=JH977553:176245-179462(-)

Full Sequence      

MFLRIRRTHWPWVVAVLFALSIFTFYYAQTVVAWTATDNVHKPAPYDAHPLFADVDPNPY
HAAGPKETGRILVVGGMGMLGKQLIRRLLDAGKAVTLYDEVVYPDEIDSIRKAHPKGNLI
ISQGRADHLAKDLPKALTRDVVGIVNVAGVSRIAECAADVERCRRLNVDHVQELVSLSAA
RVRWFIEASTTEVVVPKGDGLINELAQTKLDAEKWLADFASNNASANVHAAALRFATIYG
SVNDHPDRLALSIVRNALSHRTIQMVAGHQTVDLLHVTDAVSAIVLAMNHLATKRGPSSM
DVFTVAPNQPQTVRALIEKIMRLTRSKSPVMTIPRDGMYPEVAPAEVGTRVPGWEPKVTA
DDGLLKLATKLTEESVTFLHKKREASCHVKHSYSIADVFALEGCSGSLAMENNGYVAFAH
IKEGQEKDGVWPEPESVWRETDMPTDWTFHVSRSGRDFELSLTGSTRKREPAMNVTFEGH
AFRIKAVDADTGYLTLSLSTGAPYAPQKFDNDWENAPEDTGLSSTVFRLTPWCCPTAPPW
PFYEDDPLSSFIMDERDQYRIKWGKTRRDEFCSRLEKAHTLAEERLNVLRTTQVPLTGGE
IPSSLAGDWKARSYDRTCTNLCDHPTICVDTGDCMCVEAACPTRSRTLPGKLEWRDVLRP
NARRYFNLRPGLPAINVTRVPEDIENQREKEDPDHFDRLQTEWHGCYSADSVAERAAKLI
SQPFKNDMMVFLPHWEYTLRFPPVVEWAKQAAAKHLPESFYYGLLQVPFTFDWGKCNTIL
HHLTNVREKSRPAEELRLASSWQPMGDLNSPCYSPDQDVLIPPRTCKQDELRAAFSDVSK
VKKVAERQTLATFKGSPNGQGTSLRLKTTCPRLLPPGSLEPVWAHIPEGKTYLDLLGDTR
FCPIPFGTAGWTYRLSDVVYAGCIPVLVGDQSHMTYWSMFDWSLFSVQVFEHELDHLERI
LSGITEEDAQRKQDALMLVREAFLYPSEGHVEEAVKAYGVAKDGKDGKDGWKNGAVFYAL
HAAHLVQKTRYYAQWPWNRDE

Enzyme Prediction     

No EC number prediction in EJT50333.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT47	809	964	1e-23	0.5067567567567568

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223528	WcaG	8.62e-29	70	368	2	305	Nucleoside-diphosphate-sugar epimerase [Cell wall/membrane/envelope biogenesis].
397245	Exostosin	5.28e-19	802	964	130	290	Exostosin family. The EXT family is a family of tumor suppressor genes. Mutations of EXT1 on 8q24.1, EXT2 on 11p11-13, and EXT3 on 19p have been associated with the autosomal dominant disorder known as hereditary multiple exostoses (HME). This is the most common known skeletal dysplasia. The chromosomal locations of other EXT genes suggest association with other forms of neoplasia. EXT1 and EXT2 have both been shown to encode a heparan sulphate polymerase with both D-glucuronyl (GlcA) and N-acetyl-D-glucosaminoglycan (GlcNAC) transferase activities. The nature of the defect in heparan sulphate biosynthesis in HME is unclear.
212494	SDR_e	1.44e-17	71	288	1	187	extended (e) SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
396097	Epimerase	7.98e-17	71	292	1	229	NAD dependent epimerase/dehydratase family. This family of proteins utilize NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions.
187566	UDP_AE_SDR_e	9.47e-16	70	364	1	297	UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs. This subgroup contains UDP-N-acetylglucosamine 4-epimerase of Pseudomonas aeruginosa, WbpP, an extended SDR, that catalyzes the NAD+ dependent conversion of UDP-GlcNAc and UDPGalNA to UDP-Glc and UDP-Gal. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV23625.1|GT47	1.74e-86	64	1031	83	1124
KGB76296.2|GT47	2.10e-85	64	1031	83	1124
AAW44475.1|GT47	1.96e-82	64	1031	82	1126
AFR96705.1|GT47	2.52e-80	64	1031	83	1119
AUB26654.1|GT47	2.52e-80	64	1031	83	1119

PDB Hits     

EJT50333.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9SSE8|GLYT1_ARATH	4.72e-11	813	984	279	442	Probable glycosyltransferase At3g07620 OS=Arabidopsis thaliana OX=3702 GN=At3g07620 PE=3 SV=1
sp|Q3EAR7|GLYT2_ARATH	1.09e-10	882	984	339	441	Probable glycosyltransferase At3g42180 OS=Arabidopsis thaliana OX=3702 GN=At3g42180 PE=2 SV=2
sp|Q9LFP3|GLYT4_ARATH	3.17e-09	882	984	347	449	Probable glycosyltransferase At5g11130 OS=Arabidopsis thaliana OX=3702 GN=At5g11130/At5g11120 PE=3 SV=2
sp|Q3E7Q9|GLYT6_ARATH	4.19e-09	813	983	286	451	Probable glycosyltransferase At5g25310 OS=Arabidopsis thaliana OX=3702 GN=At5g25310 PE=3 SV=2
sp|Q6H4N0|GT21_ORYSJ	1.96e-08	891	994	288	393	Probable glucuronosyltransferase Os02g0520750 OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0520750 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.751661	0.248359

TMHMM  Annotations     

Start	End
12	34