CAZyme Information: EJT50164.1

Basic Information

• Species: Trichosporon asahii
• Lineage: Basidiomycota; Tremellomycetes; ; Trichosporonaceae; Trichosporon; Trichosporon asahii
• CAZyme ID: EJT50164.1
• CAZy Family: GH71
• CAZyme Description: Cellulase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:J6EZS1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498		52243.47	4.8598

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TasahiiCBS2479	8834	1186058	523	8311

• Gene Location: location=JH977558:337696-339372(-)

Full Sequence      

MLFTSLLASLVLASGAAANSWGGNNLLMLQGMEESAQIDFIKRQAADGSKVLRLWVRGYK
KGCEKGTNIAIDAPDFETELGKYNDETLDVLDRTLGLIQEHGQGMKVIISPHNANAIYGL
WSLTDVYTKFGPRFYNQDEPQKIYDSRLQHILEYKGKHTGKAWKDFSEVILAFDLQNEPF
VGAKDCPNLGQADKQWACKRATNMRKILSPDIKIATGGLGGAIDNKCTFMAEAMSCDAID
AISAADWNEQKGSKLMYVEELGIEWRKKGWDIAKTFSDVTSTLNSAGVPWMSWMLIPDVA
GNCKDNYNSDTDYNIIPLDKAGDIAKAMSGAAAAKSDQDWGLSAGGGSSGSSSTRPLNQG
NGTSSDVMSHTNGTSSSDNGTTTAGGSLSTGGSSSTGETASNGGSSSGETSASGETSSAG
GTSSEGTETSSQGATSPGSSTGGSTEGGKGNSQDDSGGAKMGASWSKDDASSSKEKGSWS
KDGASASKSDGKSCRLRW

Enzyme Prediction     

No EC number prediction in EJT50164.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	45	245	1.6e-32	0.6819787985865724

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
411053	dermokine	7.80e-07	354	478	172	299	dermokine. Dermokine, also known as epidermis-specific secreted protein SK30/SK89, is a skin-specific glycoprotein that may play a regulatory role in the crosstalk between barrier dysfunction and inflammation, and therefore play a role in inflammatory diseases such as psoriasis. Dermokine is one of the most highly expressed proteins in differentiating keratinocytes, found mainly in the spinous and granular layers of the epidermis, but also in the epithelia of the small intestine, macrophages of the lung, and endothelial cells of the lung. Mouse dermokine has been reported to be encoded by 22 exons, and its expression leads to alpha, beta, and gamma transcripts.
411418	ser_rich_anae_1	4.09e-05	358	480	246	386	serine-rich protein. This serine-rich protein belongs to a family with large size (over 1000 amino acids), which a highly serine-rich central region that averages over 300 aa in length. Species encoding members of this family of proteins tend to be anaerobic bacteria, including Gram-positive bacteria of the human gut microbiome and Chloroflexi from marine sediments.
411418	ser_rich_anae_1	5.16e-05	358	480	288	418	serine-rich protein. This serine-rich protein belongs to a family with large size (over 1000 amino acids), which a highly serine-rich central region that averages over 300 aa in length. Species encoding members of this family of proteins tend to be anaerobic bacteria, including Gram-positive bacteria of the human gut microbiome and Chloroflexi from marine sediments.
411525	agg_sub_LPXTH	8.04e-05	362	469	56	159	serine-rich aggregation substance UasX. Members of this protein family are repetitive, serine-rich surface proteins of the Firmicutes, found primarily in the genus Leuconostoc. The variant form of sortase signal, LPXTH, is replaced by LPXTG in members from some lineages, such as Weissella oryzae, and therefore recognizable. Some members of this family have the KxYKxGKxW type signal peptide as seen in the glycoprotein adhesin GspB, a substrate of the accessory Sec system for secretion. WOSG25_050600 from Weissella oryzae SG25 is identified in a publication as an unnamed aggregation substance, a conclusion supported by the sorting signals and composition reported here. We assign the gene symbol uasX (unnamed aggregation substance X) based on our evaluation of the family.
411418	ser_rich_anae_1	1.76e-04	357	491	389	532	serine-rich protein. This serine-rich protein belongs to a family with large size (over 1000 amino acids), which a highly serine-rich central region that averages over 300 aa in length. Species encoding members of this family of proteins tend to be anaerobic bacteria, including Gram-positive bacteria of the human gut microbiome and Chloroflexi from marine sediments.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR49152.1|GH5	2.34e-68	2	340	4	358
SMR50329.1|GH5	2.34e-68	2	340	4	358
SMQ49323.1|GH5	2.34e-68	2	340	4	358
SMY23020.1|GH5	2.34e-68	2	340	4	358
QGI85699.1|GH5	2.05e-65	7	340	12	357

PDB Hits     

EJT50164.1 has no PDB hit.

Swiss-Prot Hits     

EJT50164.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000375	0.999593	CS pos: 18-19. Pr: 0.9760

TMHMM  Annotations     

There is no transmembrane helices in EJT50164.1.