CAZyme Information: EJT49648.1

Basic Information

• Species: Trichosporon asahii
• Lineage: Basidiomycota; Tremellomycetes; ; Trichosporonaceae; Trichosporon; Trichosporon asahii
• CAZyme ID: EJT49648.1
• CAZy Family: GH5
• CAZyme Description: Alpha-N-acetylglucosaminidase, putative [Source:UniProtKB/TrEMBL;Acc:J5QXP4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781	JH977581|CGC1	87701.84	6.6917

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TasahiiCBS2479	8834	1186058	523	8311

• Gene Location: location=JH977581:323990-326375(-)

Full Sequence      

MRISLLVLAVAACAKPFGGQLRFRGLEDETAPAVSNAPVINNIPSNANRPATNGTVTSPA
ANSGAQGTAALDALVKRRLPASLQGKFTFVTAPVQSNEHDAWTVKASGGKVTITSTSTPG
LGRALLEYLRHLGGDIYWSGDTFSDLSYADADLSGSSWAEHRHLFNLVTHSYSLAFYDWA
KWEYLLDWAVLHGYNLPLAYTGQEYVYAQVWKDLGVPDEAVLKWVTGPAFHGWSRHGNIH
GNWHGTTTWQWLEGQHNLQKQILARQREFGMTPVLPGFCGFVPPELHNYIGGPDFKTYPT
WMSFPAEYTKVRAIDPEWDTWNVVQSAFLRKQKELYGFTSDYYMVDLFTESKPTSTDPTY
LKGIATAVRESIHAVAPNATWIMQGWIFVNDPKSWTETASKAFLDGAGESLLVLDLAAES
YPQWKRLKNFFGRRWLWCTLINYGQNDGLYGALDKWNHDIMDAKANGGRLSGMGIVPEGI
NNNEHLFELATDQGWSSQAIDLKQWTQNWVKRRYRGQNLDLAQKAWELLDNSVYKSNNTA
LKCTTRSLIDLRPAVSGLIGTTGNYLATAITYEPRDVVAALDNLLQSWSGAGGQQFDYDL
VDVARQVFVNAAIPIYQAMINAWNGSNKADTEKYGRELVGLINDIDRLMATSRHFRLESW
VGDARNWAQDAGAKDDMEFQARNQLILWGPATFAPWPLDRYAAKHWHGIMSEVYAKGWEL
LYQNLLKTEPKAWNKTAFASELMEKVEKPWENVKSGGVQGPQGDSVAVIRELREKYKQWL
Q

Enzyme Prediction     

No EC number prediction in EJT49648.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	108	774	6e-177	0.995475113122172

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	7.47e-149	162	497	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	1.69e-72	505	770	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA19502.1|GH89	1.52e-150	68	752	34	731
QKX62920.1|GH89	3.38e-150	68	758	21	729
UKZ51971.1|GH89	4.08e-148	60	755	17	719
QYS99001.1|GH89	2.42e-146	60	743	16	707
UKZ88341.1|GH89	3.82e-146	61	756	18	721

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	1.23e-97	65	776	3	711	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	2.40e-74	74	755	177	851	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	2.68e-74	74	755	185	859	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	2.20e-73	74	755	200	874	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54802|ANAG_HUMAN	2.86e-97	60	776	21	734	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
sp|Q9FNA3|NAGLU_ARATH	8.79e-94	166	776	161	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003304	0.996683	CS pos: 12-13. Pr: 0.8596

TMHMM  Annotations     

There is no transmembrane helices in EJT49648.1.