CAZyme Information: EJT49615.1

Basic Information

• Species: Trichosporon asahii
• Lineage: Basidiomycota; Tremellomycetes; ; Trichosporonaceae; Trichosporon; Trichosporon asahii
• CAZyme ID: EJT49615.1
• CAZy Family: GH5
• CAZyme Description: Peroxidase [Source:UniProtKB/TrEMBL;Acc:J4UEF4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		40508.58	8.9551

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TasahiiCBS2479	8834	1186058	523	8311

• Gene Location: location=JH977583:84792-85998(-)

Full Sequence      

MSLRIAPTLRTAALRLAAPRVAAPMLRRGNASAAGGQGQQQQHNQGKQGGGSKLPLILAA
LAVGGGAYYYFAEKKPAEKAQAVKEHTKADYEKVYKDIADSLEKEGYDGELRRRNLANIQ
TAPLPPLSSTGGSNYATMRFPAESGHGANAGLGVARDYLEKIHQKYPWISYGDLWTLAGV
AAIQEAGGPVIPWSPGRVDGLEVNQTPDGRLPDASQGAQHIRDIFGRMGFNDQETVALIG
AHALGRCHTDRSGYDGPWTYSPTSWSNELYRLMLDKGQKWHFKKWKGPQQFENNDKQLMM
LPTDMVLISDKGFRPWVEKYANDEDAFNKDFAKAFKTLIELGVPKENLKTQQGWAMGQED
DSDSKDSK

Enzyme Prediction     

No EC number prediction in EJT49615.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	129	343	2.1e-51	0.8352941176470589

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	7.84e-121	87	346	9	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	9.12e-69	128	342	49	243	L-ascorbate peroxidase
178467	PLN02879	2.22e-58	128	342	52	246	L-ascorbate peroxidase
166005	PLN02364	1.47e-57	128	342	51	246	L-ascorbate peroxidase 1
223453	KatG	1.51e-46	130	351	115	436	Catalase (peroxidase I) [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB74868.3|AA2	2.24e-107	88	356	104	373
UKZ73110.1|AA2	2.36e-106	87	344	78	336
QPF77267.1|AA2	2.46e-106	87	356	86	360
QRV94226.1|AA2	2.54e-106	87	344	92	351
QRV79589.1|AA2	2.54e-106	87	344	92	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AMM_A	4.32e-64	116	343	32	259	Structure of Leishmania major peroxidase D211N mutant [Leishmania major],5AMM_B Structure of Leishmania major peroxidase D211N mutant [Leishmania major]
4GED_A	5.74e-64	116	343	32	259	Crystal Structure of the Leishmania Major Peroxidase-Cytochrome C Complex [Leishmania major]
3RIV_A	6.28e-64	116	343	33	260	The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin],3RIV_B The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin]
5AL9_A	8.60e-64	116	343	32	259	Structure of Leishmania major peroxidase D211R mutant (high res) [Leishmania major],5ALA_A Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major],5ALA_B Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major]
3RIW_A	1.97e-62	116	343	33	260	The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin],3RIW_B The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CP55|CCPR_CRYNB	2.81e-108	88	360	104	377	Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=CCP1 PE=3 SV=1
sp|P0CP54|CCPR_CRYNJ	2.81e-108	88	360	104	377	Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CCP1 PE=3 SV=1
sp|Q6URB0|CCPR_CRYNH	1.04e-105	88	360	104	377	Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CCP1 PE=3 SV=1
sp|Q4PBY6|CCPR_USTMA	1.63e-104	86	349	108	374	Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP1 PE=3 SV=1
sp|Q4ING3|CCPR_GIBZE	5.42e-101	87	354	80	350	Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999231	0.000757

TMHMM  Annotations     

There is no transmembrane helices in EJT49615.1.