CAZyme Information: EJT48560.1

Basic Information

• Species: Trichosporon asahii
• Lineage: Basidiomycota; Tremellomycetes; ; Trichosporonaceae; Trichosporon; Trichosporon asahii
• CAZyme ID: EJT48560.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
738		81754.45	7.1668

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TasahiiCBS2479	8834	1186058	523	8311

• Gene Location: location=JH977584:176555-178771(+)

Full Sequence      

MLHRNHNAHPKPPPRDSSSMPSLSLKHTSPASVVDCSISDDSPALSRTAKLSLAALSPSP
NRPAPSSSSAHNSRTAARSSSVSLQPDEQPDQSSLHPRRSSLSLTRSTSTDPASPTFASS
SSSSSFTNPSFLSVNSHHHHGPDKHHLSPIPGSPLPLKRNLSDLSTGYISDTYSAEPQSI
DDVSDTASNPYFNSFPSSSTTPSNRSSSPTRKRAFSDLSRRPMSLAPPRMRSPAGKSSSS
RSRRVILIAVVLLGLIVLGTFIVLSSVSYALYIPASAFLTEAEVPWKESDVIRKLHDGSN
DTKVADMVEASAAKHMINSDDAEDDSETYSVTAVDGDNKDSVWGVDGMGTGGYWMREDWD
GTVHNTTSWDRLYDVKLRDGEKIPRIIHQTWKSDVLPEKWRTAWRECREGMADYEYMLWT
DELSRKFIAEHYPEELAMFDEYRYPIQRADAIRYFILHHFGGVYMDLDIGCRRRMDPLLQ
GEWDTVLALTKPVGVSNDLIFSARNAPFMSQTIKGLKNFNHEWVISYPTVMFSTGPMFLS
AEYSFWQSAHPIASDQPRAVRVLPKSLYGKNAPQDTVPHSFFSHFYGSSWHADDAGFITF
LGTWGKGLLYVGVAVLILGVIRLIWSKFFSTGSLRIALPSNNDYQVLPVSTPVDGLSGMN
SPTHTPLGPLSPTGEVPSWLRLFSGNANRPSPRTPGGSSSWFPWVKDAKRNRRGSDAALP
RESKRDEVDEEKELMNDW

Enzyme Prediction     

No EC number prediction in EJT48560.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	400	480	1.4e-18	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.69e-45	370	598	71	288	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	8.46e-22	397	482	1	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76679.2|GT32	6.72e-162	237	672	12	487
ADV23773.1|GT32	4.41e-158	243	672	68	537
UOH84801.1|GT32	2.85e-150	237	673	12	488
AAW44921.1|GT32	4.11e-150	237	627	61	498
AUB28991.1|GT32	4.39e-147	259	673	83	537

PDB Hits     

EJT48560.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	2.57e-53	370	601	42	265	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	2.63e-53	383	595	55	256	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	4.79e-53	381	610	62	281	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P38287|CSH1_YEAST	2.85e-51	383	598	62	267	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.69e-47	366	654	67	344	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

Start	End
245	267
607	626