CAZyme Information: EJT48431.1

Basic Information

• Species: Trichosporon asahii
• Lineage: Basidiomycota; Tremellomycetes; ; Trichosporonaceae; Trichosporon; Trichosporon asahii
• CAZyme ID: EJT48431.1
• CAZy Family: GH16
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:J5SZZ0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
596	JH977584|CGC5	64511.44	5.8238

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TasahiiCBS2479	8834	1186058	523	8311

• Gene Location: location=JH977584:429772-431562(-)

Full Sequence      

MLALLLLAELACGLSLGLFDKTYDYVIVGGGTAGLTLAARLSEDPSISVGVIEPGTTYKL
SNPIVSDTPLTGALFSGSDLFDTNPLVDWNLKTEPLKGGDNRVVHYARGKCLGGTSARNL
MLYQRPDKGSLDMWADVVGDESYRWDAFEPFFKKSVQFTPPPNEERGNASAQFDAGDFDP
NGGPLSVTYPPYAQPMSSWMIPGMQQSLNIPEIPGFSGGNLMGSSWASLTVQKENGKRES
SASAFLDPIRWGRSNLHVHELSSVRKILFDDQKNAIGVELKLGTKINARKEVILSAGAFH
SPQILMLSGVGPAAHLQERNIPVVADRPGVGQNLTDHVLAGPSYRITVDSLTRLALNPLI
AVNEFLLNFSRNKGILTNNGADVIAFEKIPRDQLQASTLSILDRYPESWPDAEYVSAPAY
VGDFGALLLDQPRDGYMYGTLMAAVANPQSRGSVTLRSNRIEDKPVIEAGWLTHPADIDV
MVASYKRARAVFTSDAVKGILADPVEYHPGLDVKTDEQILAAIRKDVMCVWHAAVSCRMG
RRDDPTAVVDNKAKVIGVNRLRVVDASSFALLPPGHPQSVVYAFAEKIAADILAGH

Enzyme Prediction     

No EC number prediction in EJT48431.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	21	593	3.4e-172	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.23e-105	20	595	3	533	choline dehydrogenase; Validated
225186	BetA	5.48e-95	20	596	5	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
215420	PLN02785	6.84e-38	15	581	48	565	Protein HOTHEAD
398739	GMC_oxred_C	3.15e-36	448	588	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.50e-28	100	337	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ59383.1|AA3_2	4.34e-216	23	595	39	624
UQC81385.1|AA3_2	1.47e-214	20	596	46	627
QDS74529.1|AA3_2	9.25e-209	20	593	33	612
CDP30930.1|AA3_2	8.50e-208	20	593	48	625
VBB84128.1|AA3_2	9.74e-207	20	593	48	625

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	7.14e-60	23	593	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.74e-59	23	593	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	6.15e-57	21	596	4	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3NNE_A	1.20e-54	18	589	9	523	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
2JBV_A	1.66e-54	18	589	9	523	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A075TRK9|PATE_PENEN	9.69e-163	20	592	49	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	1.37e-162	20	592	48	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.07e-154	20	594	33	609	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	2.47e-147	20	596	38	611	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q12062|AFLK_ASPPU	6.49e-138	21	595	73	642	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.018999	0.980956	CS pos: 13-14. Pr: 0.9484

TMHMM  Annotations     

There is no transmembrane helices in EJT48431.1.