CAZyme Information: EJT48113.1

Basic Information

• Species: Trichosporon asahii
• Lineage: Basidiomycota; Tremellomycetes; ; Trichosporonaceae; Trichosporon; Trichosporon asahii
• CAZyme ID: EJT48113.1
• CAZy Family: GH13
• CAZyme Description: Exo-1,4-beta-D-glucosaminidase [Source:UniProtKB/TrEMBL;Acc:J5QMG3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
870		96854.40	4.7774

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TasahiiCBS2479	8834	1186058	523	8311

• Gene Location: location=JH977584:1382957-1385626(-)

Full Sequence      

MITTLLLAAAGLAQVATAGDADQQPHLLTNGPGQSAAIPRWDIQSTAKVGTDLGKLSTTG
VDTANWHHTTQSRCTLMGCLLDAGVYKDSELWFSENLKGFDGSLFQVPWVYRNEFSLPPA
KDGQHFLLETNGITSEADIFINGNQIANSTFQAGSYGGHVYDITCAADEKNAIVVQVHPT
NYAYDLAVGFGDWNPYAPDNGTGVWRDINVRQTGDISMGPLSVLIDLPLPAGEKDATVTV
RAEAKNRGRSDVSFRANAAIADPSGKAICHLWQDLKLKAGESRVVEFKQTVAQPQIWWPR
QWGGQPLYTATVDFTINEQLSDKRETTFGIRSVTSAINQYNDTMFTVNGKPFQVIGAGYN
ADQFLRWDGRYFADIVEYMFDMGLNTIRLEGKMEQPELYEIADRAGLMVMAGWECCDKWE
SFEYNHDLALNPPPVWDDREYGIARYSMAHEAQVMQPHPSMLAFLIGSDYSPDERATRGY
IEALQQAGWQVPIIGAASFREPAVIKSGMKMQGPYDWVPPNYWHDLPDTASLQDTRFGTS
FGFGSELGAGVGTPELGSLRKFLSDSDLDDLWKNPDKGLYHMSNADSQFHDRKVYNAALF
ARYGKPSSLEDYLMKAQLSDYEATRAQYEGFASRWNAERPATGIIYWMLNNAWPGLHWNQ
FDKYLRAAGSYFGTKTGARPEHAAYDYVSRDVWLINRSLDRGGKRTVEIEANKARTIGKV
EGLDEVDGVVLLRLLLKDGDAVFSRNVYWLGASLDELDWEASDWWYTPTTKYADYTALSS
LKPADVATTVVRGKDGYQLTLENRSDVPAFFVSVNLIDAQGHDVNPTVWSDNYVTLWPHE
KMDLIARVRGGNAAKVQVKGYNVEAGEVAL

Enzyme Prediction     

EC	3.2.1.165:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	104	717	1.8e-55	0.586436170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408168	Ig_GlcNase	7.94e-44	764	863	1	104	Exo-beta-D-glucosaminidase Ig-fold domain. This domain can be found in 2 glycoside hydrolase subfamily of beta-glucosaminidases (EC:3.2.1.165) such as CsxA, from Amycolatopsis orientalis that has exo-beta-D-glucosaminidase (exo-chitosanase) activity. It has an immunoglobulin-like topology.
225789	LacZ	4.55e-21	96	469	52	406	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
395572	Glyco_hydro_2	1.27e-09	233	331	15	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236657	PRK10150	5.45e-09	280	487	228	435	beta-D-glucuronidase; Provisional
407625	Ig_mannosidase	1.41e-05	783	841	1	51	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY64671.1|GH2	0.0	6	868	9	894
UKZ45905.1|GH2	0.0	28	870	23	890
BAD99604.1|GH2|3.2.1.165	0.0	6	870	9	892
UKZ70940.1|GH2	0.0	28	870	22	890
UKZ93313.1|GH2	0.0	28	870	22	890

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VZS_A	7.00e-172	2	862	17	890	Chitosan Product complex of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZS_B Chitosan Product complex of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2X05_A Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X05_B Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X09_A Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X09_B Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis]
2VZO_A	2.74e-171	2	862	17	890	Crystal structure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZO_B Crystal structure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis]
2VZT_A	5.41e-171	2	862	17	890	Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZT_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZV_A Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis],2VZV_B Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis]
2VZU_A	1.63e-169	2	862	17	890	Complex of Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZU_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis]
7CWD_A	1.18e-16	107	427	65	370	Chain A, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4R1C4|EBDG_HYPJE	0.0	6	870	9	892	Exo-beta-D-glucosaminidase OS=Hypocrea jecorina OX=51453 GN=gls93 PE=1 SV=1
sp|C0LRA7|EBDG_HYPVI	0.0	28	870	23	890	Exo-beta-D-glucosaminidase OS=Hypocrea virens OX=29875 GN=gls1 PE=2 SV=1
sp|D4AUH1|EBDG_ARTBC	2.24e-270	28	864	28	878	Exo-beta-D-glucosaminidase ARB_07888 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07888 PE=1 SV=1
sp|Q82NR8|EBDG_STRAW	2.71e-187	24	862	40	895	Exo-beta-D-glucosaminidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=csxA PE=1 SV=1
sp|Q56F26|EBDG_AMYOR	2.56e-171	2	862	17	890	Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis OX=31958 GN=csxA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999766	CS pos: 18-19. Pr: 0.9807

TMHMM  Annotations     

There is no transmembrane helices in EJT48113.1.