CAZyme Information: EJT47475.1

Basic Information

• Species: Trichosporon asahii
• Lineage: Basidiomycota; Tremellomycetes; ; Trichosporonaceae; Trichosporon; Trichosporon asahii
• CAZyme ID: EJT47475.1
• CAZy Family: GH105
• CAZyme Description: Trehalase [Source:UniProtKB/TrEMBL;Acc:J4U9W3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1060		109856.09	6.5055

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TasahiiCBS2479	8834	1186058	523	8311

• Gene Location: location=JH977589:1122954-1126260(-)

Full Sequence      

MLMLVLLPFLIGTAGAQNAAGAALPAGSPSAAANQPPQQGTSGFGEAAPAGSATPTASPS
TLAGTPGAAGAGAGGNSGSGTSAPPTSTSVSTAAPSASDPSAVVPGQDNPPPPQWWCNNG
GNATYCPGALLQDVQLSGVFTDSKTFVDRPTNGSQADVFAAWNSTINGNVTAGQIVDFVL
KHTTGEGQELSQVAIQRNASNATTQSNISDPIYSAWVKKVDSYWDLLIRESNQSRLCNGT
TCDYSLIPLNHTIVVPGGRYREVYYWDSYWILQGLLASKLEYYAWSLLQNFMDLIEDYGF
IPNGGRKYYLNRSQPPVFVQMVHEYIKQTGNVTILQRALPSMERELAWWHQNRTLQVTSP
WSGKNYTVAHYAVNNSAPRPEGYVEDYDTVNHAQPPLNASQQADLYAELATGAESGWDYS
ARWLKTPVANVSNNEEALRQLNLRAIIPHNQTGGNQTTAGGGMGSAGSNQTGAAGGMKPS
PATTQAAQTNAAQGSTPPQQATTQGATQQGGAQQGSQQGSNAQGSAPAQNGATQTQGTNG
GGMRRRWWRRQQGDPNADPNAPTSNQGGASGNTGNGGNTGNTGNTGGSTSSSTGTGKTGN
TSAQGQNGATSNQGTGAGTPGMGQNGGSSNAGAEGGQGTGSGTGSTGTGSMGNQTMGGGD
NTGGGNGTTAEKHRKLAQNFKEALLDLNWDGDRAFFYDFNTTDNKRTPFYTAGGWWPLWQ
NVTPSNLTEEQALRMASGVRYLLQKYDGAPAAATYLVSGLNWDFPNVWPLHVYTTIKGLD
TLERTIKNASVLPQLSLTNFSAVTPNQLGMNETQLPPQPASTRGNVTYANQTQHLLNAAA
GTLPWPRGLALEIAARYLNSAFCSWYSTGGQLNGTLQRLPLSELNATGTYHEEPGVEGGK
MFEKFNITDLDAAGGGGEYTVQVGFGWTNGVVLWAAERFGQYLRTPTCPLILITQNNGTS
SGNSTGPPPNSTPGGGGAGGAQPSGQRSTAILPMSSSLPPANGNTVTTTPAQSPQGGNAA
QPTTSAAAPAGNNGGGNGGGTSASAPTARSFQFVGRRIHN

Enzyme Prediction     

EC	3.2.1.28:1	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	140	448	1.7e-85	0.5926680244399185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	1.12e-67	140	424	3	285	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	2.22e-63	123	427	11	314	alpha,alpha-trehalase
224541	TreA	9.37e-43	128	427	59	340	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	4.66e-41	130	448	52	339	alpha,alpha-trehalase TreA.
183934	treF	3.31e-40	130	427	62	335	alpha,alpha-trehalase TreF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW44482.2|GH37|3.2.1.28	1.10e-238	88	959	32	721
KGB76251.2|GH37	4.08e-236	88	959	32	722
ADV23702.1|GH37	3.48e-233	88	959	32	717
AFR96750.2|GH37	1.64e-232	88	948	32	711
AUB26705.1|GH37	1.64e-232	88	948	32	711

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	4.80e-38	178	427	82	327	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	4.99e-37	178	427	82	327	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	8.20e-35	128	448	15	304	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	1.59e-32	128	448	15	304	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
5Z66_A	1.62e-32	128	427	52	328	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	5.58e-66	125	424	54	354	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|P19813|TREA_RABIT	9.79e-59	125	448	33	346	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|O43280|TREA_HUMAN	3.02e-55	125	424	33	327	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|Q8MMG9|TREA_PIMHY	1.06e-54	125	459	50	391	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1
sp|Q9JLT2|TREA_MOUSE	2.22e-54	125	424	30	324	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000443	0.999499	CS pos: 16-17. Pr: 0.9696

TMHMM  Annotations     

There is no transmembrane helices in EJT47475.1.