CAZyme Information: EJT46274.1

Basic Information

• Species: Trichosporon asahii
• Lineage: Basidiomycota; Tremellomycetes; ; Trichosporonaceae; Trichosporon; Trichosporon asahii
• CAZyme ID: EJT46274.1
• CAZy Family: AA3
• CAZyme Description: Glyco_hydro_cc domain-containing protein [Source:UniProtKB/TrEMBL;Acc:J6EPC8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	JH977603|CGC1	40028.22	5.3539

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TasahiiCBS2479	8834	1186058	523	8311

• Gene Location: location=JH977603:700307-701950(+)

Full Sequence      

MLVSRLLTVAALAQLASCSPVSSADSLPSSPSLSALNVSSLSDTTALDIVGGTCIGQTAL
DKRNNDDVYRQNARKRGIPWQLRGSGSLAPFHTLASYYTYSPYGYNVSEAGPGFVPQLWG
CSDAHVDEFQARMNSEWAVAGSDQKARLLKHKEVLTFNEPNEAHQANCTPALAAAVWKKT
VEPLKEQGWRVGAPAVNTGGWGMSWMLDWWRECNGSCHPDFLAVHFYNPSSAALPVVLTQ
WHTTFNLPLQVTEIAPMSWPPRDKEHIDSTQVRNYMQSVMAWMDGTEWVERYYWYGARWD
MDKLNPELALLKDSQTLSPLGELYVSSQSPQYAWNLEESGEARLGVNLGMLLGLLLAALV
SV

Enzyme Prediction     

No EC number prediction in EJT46274.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	93	324	6.8e-55	0.9598214285714286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	7.14e-53	97	324	21	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW43837.2|GH128	7.97e-45	67	362	17	334
ADV22591.1|GH128	4.74e-44	84	346	6	281
UOH82541.1|GH128	1.24e-43	84	314	6	238
AUB25440.1|GH128	1.82e-42	67	362	33	350
AFR95613.2|GH128	1.82e-42	67	362	33	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB0_A	1.00e-16	110	292	38	206	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAY_A	1.66e-16	110	292	69	237	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]
6UB7_A	6.94e-15	154	325	107	282	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UAX_A	3.71e-11	111	333	138	349	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]

Swiss-Prot Hits     

EJT46274.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000135	0.999863	CS pos: 17-18. Pr: 0.9467

TMHMM  Annotations     

There is no transmembrane helices in EJT46274.1.