CAZyme Information: EJT45951.1

Basic Information

• Species: Trichosporon asahii
• Lineage: Basidiomycota; Tremellomycetes; ; Trichosporonaceae; Trichosporon; Trichosporon asahii
• CAZyme ID: EJT45951.1
• CAZy Family: AA2
• CAZyme Description: Alginate_lyase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:J5SJL0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447	JH977607|CGC5	49344.84	5.0311

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TasahiiCBS2479	8834	1186058	523	8311

• Gene Location: location=JH977607:17982-19403(-)

Full Sequence      

MLVIPLLIVLSAFLAAASPVRRGIARPRPNTVILDPDYMQRAAGNPDQGELGNLKGLADR
LLTVGPWNDYASQGVYWWATTASGCPYELRDGQRNPEIDLYTDRKDSSNMVNSVYYLSLA
WWYTDDARYRQKAGEVLRTWFINGPTRMNPNLQHAQLIPCKCTGRKEGIIDFSQVYTDVL
DAVALLNTKFDGAWTQQDANAFRDWNQQYLSWLTGSEFGQKELAAKNNHGTFALMQVIAL
QMFLGQNAAATAQVIEQRSRIDQTIAIDGTTPLELKRATSWHYANFVLVAYLRTCAMAAR
LGIDLWGFHGAQGQSIGRAVDYLAPYAAGKEWPWPKTSAPLKLFAAHDIMHFGAERGLGD
PKRALETIPAPPGGSIWKLAPAVRQQDSTNVLGVFHSAQEAIIDDPTPAEEVASLEGEAP
QEEIDALKAELPSDQIQLLDELTGGGI

Enzyme Prediction     

No EC number prediction in EJT45951.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	66	331	1.5e-88	0.9498207885304659

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	1.87e-75	68	332	16	273	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWE48973.1|PL38	1.13e-113	6	388	10	422
UQT60646.1|PL38	3.00e-113	6	388	12	420
QEV71783.1|PL38	5.12e-112	6	388	10	422
QIB46939.1|PL38	9.93e-112	25	388	43	432
QWA21160.1|PL38	2.05e-111	6	388	10	422

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	4.19e-42	57	335	48	329	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

EJT45951.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000628	0.999361	CS pos: 17-18. Pr: 0.9094

TMHMM  Annotations     

There is no transmembrane helices in EJT45951.1.