CAZyme Information: EJT45648.1

Basic Information

• Species: Trichosporon asahii
• Lineage: Basidiomycota; Tremellomycetes; ; Trichosporonaceae; Trichosporon; Trichosporon asahii
• CAZyme ID: EJT45648.1
• CAZy Family: AA14
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:J5Q5Z2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
661		75215.70	5.5087

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TasahiiCBS2479	8834	1186058	523	8311

• Gene Location: location=JH977607:649190-651323(+)

Full Sequence      

MIRSTRIFIFLGLACFLFTLHLFYSEHHRQQPTQRSFTDDVEPVNYIGGGRATAAAAAAR
AAEEPASLYDNLELEQEYFTTDSRSQPQHPLKSPNQDFHYEGVSIDEKGLMAFDPALHDK
HPVELLIERGRAQAKAIDERIASVKTLEDAVADYEKAWGMKPPKGFDNWFKFTQETGSVS
VPSMFPLAHRPFQQFLSLTPKEIKDRIEVGANKKGPLWTFTFVPDGQGDEGTQTDEDGTW
EPEDWHTRGRGRVKPSNTLTLILPILAKLPEEFFTQDPPVTMLFNNEDGPAGRIHQKVQE
RGETLGRAGKHWPETQLKAAEQAMRWTAGWHWTCPDGSPLRESAADKVLNDEGGSDSSSQ
LKTFVADFYKSTDICYNPEIRELHASAIADYRMPANPLVPQISVCRMMRNNDIVGVPLDA
VYQNPPFVPWAQKSNDKVLWRGSPTGIFHNKQMPWRQAQRERLHFLANNKSDAAVPVLVS
GLEGLRVKEFPVNQMNEAWFDIGLFGGPAQCSHEDGSCAEMDAEFEWRPSVRGNQALEYK
YVVDVDGNGWSSRFRRLLKSNHVVLKSTLFPEWFNDLLVPWYHYVPIRFDYGDLYDVMAF
FKGAPDGSTKGRDDLAEEIAKNAHTFVDSHWRVPDMESFMMLVMLEYWRLVSDDRKAMSY
P

Enzyme Prediction     

No EC number prediction in EJT45648.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	395	651	6.6e-60	0.908

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	4.01e-16	539	650	146	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	5.28e-10	520	650	194	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW41853.2|GT90	4.18e-209	102	660	57	629
AUB22757.1|GT90	1.49e-200	121	660	82	635
AFR93241.2|GT90	1.49e-200	121	660	82	635
KGB74299.2|GT90	7.86e-195	102	646	62	621
UOH81501.1|GT90	2.17e-190	121	646	82	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	4.73e-09	397	652	115	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	1.56e-06	538	656	271	384	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.37e-77	121	655	152	660	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	1.26e-09	397	652	143	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	2.82e-08	397	652	143	371	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q8BYB9|PGLT1_MOUSE	4.97e-08	397	652	143	371	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2
sp|Q5E9Q1|PGLT1_BOVIN	8.73e-08	538	652	264	371	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997180	0.002859

TMHMM  Annotations     

Start	End
7	24