CAZyme Information: EJT45499.1

Basic Information

• Species: Trichosporon asahii
• Lineage: Basidiomycota; Tremellomycetes; ; Trichosporonaceae; Trichosporon; Trichosporon asahii
• CAZyme ID: EJT45499.1
• CAZy Family: AA1
• CAZyme Description: Ricin B-type lectin domain-containing protein [Source:UniProtKB/TrEMBL;Acc:J6EMI6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
157	JH977607|CGC4	16789.97	4.3467

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TasahiiCBS2479	8834	1186058	523	8311

• Gene Location: location=JH977607:1383554-1384124(-)

Full Sequence      

MLAALLATVTLAAPALAANHIKVQGAEFDLCIDNTDGKEVAGNPLQVWKCYTGSSNQAWN
FSDTGKYPTTFKLGDSNLCMGVQQSPLADGAPVVLMDCAAGYDHTTWSAPNGRICLLGTN
YCLQLDDDCAHDGTKLKVMTLSTSPSQLWDVKEPAYE

Enzyme Prediction     

EC	3.2.1.39:5	3.2.1.14:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	20	154	8.5e-18	0.6914893617021277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238092	RICIN	2.13e-18	29	150	10	123	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	3.40e-13	23	149	5	126	Ricin-type beta-trefoil lectin domain.
214672	RICIN	2.82e-12	24	149	2	115	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
411519	lectin_2	3.82e-11	3	149	78	238	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
411518	lectin_1	2.79e-05	12	149	704	834	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIX35058.1|CBM13	2.41e-10	25	152	347	470
CAG9282858.1|CBM13	2.69e-10	26	152	40	169
ANO42373.1|CBM13|GH3	6.09e-09	26	149	1324	1445
QEV03473.1|CBM13	1.41e-06	31	105	49	133
ARF81968.1|CBM13	1.41e-06	31	105	49	133

PDB Hits     

EJT45499.1 has no PDB hit.

Swiss-Prot Hits     

EJT45499.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000218	0.999737	CS pos: 17-18. Pr: 0.9763

TMHMM  Annotations     

There is no transmembrane helices in EJT45499.1.