CAZyme Information: EHY61084.1

Basic Information

• Species: Exophiala dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala dermatitidis
• CAZyme ID: EHY61084.1
• CAZy Family: GT8
• CAZyme Description: endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
663	JH226137|CGC7	72154.54	4.7628

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EdermatitidisNIHUT8656	9356	858893	71	9285

• Gene Location: location=JH226137:771575-773724(+)

Full Sequence      

MPYSLTWSQGTGNARSWGMAISHVEESQKVFGAANTAIPGSPNSYYINPLGIQSIILSAS
EFGSSTILTTDSLQAFSANVQLQPSAGSSSTLTIPVVQGMGFVTGEYYNLQPALQSSVFF
RNVAAAGQPKQGVYKYKVTLEDGKVWLIYAIPSHGISPNFQLVSSTLLQGISNWYGVIQV
AKLPDASQESIYDRAAGAYPTAGHIGGYAHGSKAQYSLSWSKGGSFAGNATLLMFALPHH
VDSFDNITQAAVTKLQLSTTTNGNATAVVADYWVLEEDGLPTTLDFAPWRPASSTQSLVA
MSSAAIAAIQSVAATEASQNMSAQTNLNSMYYSGKALSKFATLVYTMHDLTDQQDLAKSA
LLELEACFEVFAQNQQQYPLIYDTDWKGLVSSASYVTGDSGVDFGNSYYNDHHFHYGYFL
HAAAVIGYLDPTWLTNNKDYVNALARDVSNPSALDQYFPVFRSFDWYHGHSWAKGLFESG
DGKDEESSSEDAMFAYGLKMWGKTIGDASMEARGNLMLSVLARSLQSYFLMTSDNTNQPE
EFIGNKVTGILFENKADHVTYFGTDLSYVQGIHMIPIMPFSTLTRTEKFVTEEWSTYFAD
GAVRQASDITGGWKGIVYANLAIINPKAAYNFFTQSDFDMSWIDGGASRTWYIAMSAMLG
GAS

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	1	654	2.1e-211	0.932475884244373

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	2	661	112	757	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	311	653	12	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	4.10e-128	2	291	37	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBF89420.1|GH81|3.2.1.39	2.64e-284	2	663	246	905
AAF13033.2|GH81|3.2.1.39	3.77e-282	2	657	67	721
EAA66571.1|GH81	1.21e-281	2	657	238	891
BCS08078.1|GH81	1.68e-277	2	661	235	893
BCR95538.1|GH81	7.50e-277	2	661	280	938

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	9.73e-101	2	657	65	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.70e-100	2	657	90	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.12e-97	2	630	65	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.82e-27	382	636	393	637	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	3.11e-18	331	649	361	674	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	7.61e-264	2	657	248	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	3.94e-175	2	662	57	705	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	4.31e-161	2	659	456	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.81e-157	18	659	117	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	1.00e-148	1	657	482	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998221	0.001823

TMHMM  Annotations     

There is no transmembrane helices in EHY61084.1.