CAZyme Information: EHY60365.1

Basic Information

• Species: Exophiala dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala dermatitidis
• CAZyme ID: EHY60365.1
• CAZy Family: GT59
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309		34248.09	7.5614

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EdermatitidisNIHUT8656	9356	858893	71	9285

• Gene Location: location=JH226136:1393704-1394824(-)

Full Sequence      

MSFKRTMKAFCARVVQRLKDQTPVQRECYTQTVAETKAAGTPPGPPSGHKPHNPPPPGPG
KNVCGSSNRKSGDVRRDGGKWVVQGVGSFDNHATYTFDQDNFPAGLLRSNYTCRQQELMG
PDQIPYNIRYDQDNVQVSKGVLTLTVPGRQDPDKDPDQAVSCAEVTTAEQNILYASVRTN
AIFSQVPGTCHGLFFYKSDCQEIDIEYLTDSSSLSIVGPRQANPIWYTNQAVDPKSRPAT
RATGPAPSDCAAQVHEYRIDWTSQYTAFYIDGNLQQRFPLNVPSQPGPWVWNNWANGDKG
AYFSNLFFA

Enzyme Prediction     

No EC number prediction in EHY60365.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	135	299	2.3e-31	0.84375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	2.44e-32	125	301	22	191	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185693	GH16_laminarinase_like	3.04e-06	130	292	35	198	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185684	GH16_lichenase	1.39e-05	125	295	24	184	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	1.59e-05	130	296	1	157	Glycosyl hydrolases family 16.
185694	GH16_CCF	3.33e-04	255	308	208	267	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI62369.1|GH16	3.56e-50	67	300	25	239
QKD62486.1|GH16	1.41e-49	65	300	23	239
QPC71194.1|GH16	1.14e-48	67	300	26	240
QPC59862.1|GH16	1.14e-48	61	300	22	240
CCT75335.1|GH16	4.36e-48	65	300	23	239

PDB Hits     

EHY60365.1 has no PDB hit.

Swiss-Prot Hits     

EHY60365.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EHY60365.1.