CAZyme Information: EHY59332.1

Basic Information

• Species: Exophiala dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala dermatitidis
• CAZyme ID: EHY59332.1
• CAZy Family: GT32
• CAZyme Description: alpha-1,3-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		40698.01	9.6339

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EdermatitidisNIHUT8656	9356	858893	71	9285

• Gene Location: location=JH226135:1352569-1353675(-)

Full Sequence      

MAQVSMFLDGERDYSKITGPTGPLVYPALHVYIYTALYYLTDEGTNILRAQFIFAGLYLV
TLAVVLACYRRVGAPPWLLVPLALSKRMHSIFLLRLFNDCWATLALWTAIYLLQRRQWRS
GALIWGLGLGVKMTLLLAAPAIGVVVLQGSGTRQAIWSGISVALLHLLLALPFLGKGASS
QYFQRAFDFGRQFLFKWTVNWTFVGPETFASPSFAVGLLLLHVAILSVFLQSKWTKPSAC
AISDFVKKYAGSLREDEHLRISSKITPTFVMDSVLGSMVIGMLCARSLHYQFFAYLGWAT
PYILWRAGGSPVLVLANWAVQELSWLVFPSTDTSSMLVVAELALQVVCALVAPAVDHISP
PKAHDKTS

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	1	335	1.6e-120	0.9175824175824175

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	1.52e-154	1	335	29	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60805.1|GT58	4.93e-123	1	344	74	419
AEO66311.1|GT58	9.59e-123	1	346	59	420
QSS55330.1|GT58	6.43e-122	1	346	50	388
AAK07848.1|GT58	9.95e-122	1	346	66	415
QSS72893.1|GT58	1.83e-121	1	346	50	388

PDB Hits     

EHY59332.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C1K8|ALG3_NEUCR	1.77e-122	1	346	66	415	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	2.39e-119	1	347	112	451	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|Q2U6A4|ALG3_ASPOR	5.45e-117	1	346	50	388	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	1.97e-113	1	346	58	396	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A2RA94|ALG3_ASPNC	9.71e-109	7	345	52	383	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000021

TMHMM  Annotations     

Start	End
47	69
91	113
123	145
157	174
208	230