CAZyme Information: EHY58287.1

Basic Information

• Species: Exophiala dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala dermatitidis
• CAZyme ID: EHY58287.1
• CAZy Family: GT2
• CAZyme Description: alpha-1,6-mannosyltransferase Och1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		44867.87	6.4544

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EdermatitidisNIHUT8656	9356	858893	71	9285

• Gene Location: location=JH226134:1998143-1999400(+)

Full Sequence      

MVSGTHLTRYWAATIIVVCVLYWSLHRSSISVLSSHLPKPNNNKPSPANVDKSLPLSRPR
VEMDEAEESQHLAEALESTFVPIQQYPSRFPRIVWQTANEHGREKYASKAETWKKVQGFE
YNFLNDDQANDFVHENFASRPAIIKFWDGLGVPVLKADFLRYLLMLAAGGVYSDIDTSML
VHPDRWIPIDLGANTVNAIIGIEYDDHTYPMFVRPIGLCQWTLMSKPGHPIFELAVQRVI
SNLEYIARRKRVELPQLTLDKMEVLEATGPGMITDVVMHVLNEQGQNVTWDTFHDQKEPK
LYGDVLILPINGFAGSQKHSHAGDPAYGEKYVQHHFGRSWYNPDNAGTDADKAAAAAEEQ
KKKEKEKEEQERKEKEKQKEMEKEKQKEKEKTA

Enzyme Prediction     

No EC number prediction in EHY58287.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	107	188	1.5e-16	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.07e-18	76	266	68	259	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	8.54e-08	111	188	9	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
USW54832.1|GT32	3.85e-97	105	341	4	242
QKX62098.1|GT32	3.69e-47	89	341	54	319
QKX64739.1|GT32	3.00e-46	90	345	62	323
UQC86260.1|GT32	4.84e-45	90	336	78	338
CBY02465.1|GT32	5.04e-45	41	345	62	377

PDB Hits     

EHY58287.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	4.52e-43	86	340	138	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	9.36e-39	89	313	129	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	4.86e-31	90	340	99	375	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	8.43e-25	14	354	16	477	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	7.07e-10	91	344	83	285	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

Start	End
7	26