CAZyme Information: EHY57668.1

Basic Information

• Species: Exophiala dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala dermatitidis
• CAZyme ID: EHY57668.1
• CAZy Family: GH76
• CAZyme Description: glycosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
683	JH226134|CGC10	76868.12	8.5260

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EdermatitidisNIHUT8656	9356	858893	71	9285

• Gene Location: location=JH226134:254278-256497(-)

Full Sequence      

MSAEKDAAVMAKPVSVDAHVPVTSVPGAAPEPVNTVQQDNEPVKESNELALMPYNIITVE
KKQPVPTSYFSNTLSAIGLANVTGHLIMLHVNIASAKSAGHENLLPAKCFAYAQSFECVS
VIAESLWRLTVSFIRNPVPRPTYRILGDNVPGVDLIVVACGEPVDIVLDTVNAACHVDWP
VDKLRVILADDGDDKSLRAEVKALRKKHPNLHYFARYKPDGVHHGYKAGNLNATLKWVQN
KLPGGRHEFMAVLDADMIPEPCILRALVPHALKSPNVGMVTTAQHFYNIPDNDPLYQANV
TGTGADDGFRDSVGAAWCPGSGFVLRTRAWVSMGGFPEFTITEDLMTSWFLHGLGWQIAL
CHEILQWGIQPDCLLTHLKQRRRWWTGHVRDAFRTNFSLSDPRLEQATAVQRIAMFHHCC
RPYLNTLFKAFSMILMAMALYFQGQIIATPSENTLWNMMMSCFLAKFLTKVSDWRGARAL
SHWNLRRRHATNTWLGIHFARDVFFSALPKSIGGLRLGFDVTGVADNQQPVKERDAERRP
RLLTRLWQMHKQEGILYHACLAFVMVYLMYRAVKVEIDLSTYGGAIIVDDDFWRRILTGV
GYPGLNLIEVVPLFLTPVVYAIFPPTMPPRRARMMKDEDGVWRPREDCKGIKWTKASFWL
EIPHALGLIWTVTAYFILRHLQG

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	156	385	6.8e-21	0.9652173913043478

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	1.61e-78	151	390	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	1.17e-32	139	468	42	357	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	7.15e-26	135	417	247	517	cellulose synthase catalytic subunit; Provisional
133045	CESA_like	6.95e-20	155	344	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
404520	Glyco_tranf_2_3	1.38e-17	151	384	1	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21077.1|GT2	2.51e-86	65	675	198	793
QPC73057.1|GT2	4.70e-86	65	675	252	845
ATZ49458.1|GT2	9.77e-86	140	677	247	783
CCD45106.1|GT2	9.77e-86	140	677	247	783
UQC88669.1|GT2	1.14e-85	93	675	387	958

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	2.31e-22	135	417	260	530	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8Z291|BCSA_SALTI	2.36e-23	135	417	260	530	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
sp|Q93IN2|BCSA_SALTY	7.22e-23	135	417	260	530	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
sp|Q8X5L7|BCSA_ECO57	5.08e-22	135	417	260	530	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
sp|P37653|BCSA_ECOLI	1.17e-21	135	417	260	530	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
sp|Q9WX61|BCSA3_KOMXY	2.28e-21	112	390	103	379	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999953	0.000078

TMHMM  Annotations     

Start	End
434	456
554	573
601	623
656	678