CAZyme Information: EHY57616.1

Basic Information

• Species: Exophiala dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala dermatitidis
• CAZyme ID: EHY57616.1
• CAZy Family: GH76
• CAZyme Description: laccase TilA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
732		75224.33	4.6266

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EdermatitidisNIHUT8656	9356	858893	71	9285

• Gene Location: location=JH226134:117583-119781(-)

Full Sequence      

MAVASLLKAFAALTLVSSVAAGSSNSSSSVCATSSKCVPFTIDVTWGKPDSDIGVERDVI
LTNGTLPGPPLKLKVGDCVDFTVINNLDTVTGVHFHGIRQNGTPWADGVPGVSQYRIQPG
STYMYQWTAEEAGSYFYHAHYKGQMMDGLYGAILIQSADDADLPWSQISSSDDDLKQLAA
AAADVETVFASDWSQFTFSEFFDIEQSANIDDACTDSIILNGKGSVYCLSIAELTANAAV
QVPKILNGTSLTAKGCIPASNALIQGTKYNRTLSALPAEAYDKCTPVTGANYTYEVDASN
GWAAMSFINPGGFALLKVTIDSHKLHIYEYNGQYIVPQTVDQFVLANGDRISFFVKLDQT
PGDYTIRVANDGINQVISGFGTLSYKNGGKKASGVAVMNYGGQNTTAITTFNEAAAAPYP
AQTVGTDVATTFVLDIMKSPSDPTDSWAWTLSGVQSYNMSRDDEEPPLLFQNPANVPDSD
LVLKTKINTWVDLILKVEGPIAQPHPIHKHANKFFVIGSGVGSFNYTSVAAAQAAGLQFN
LVNPPYVDGYTSTPAEGSAAWMVFRYYVNTPGAWLLHCHVQSHLSGGMAVAILDGVDAFP
SVPSDVGKVCPGNGKSGATGGSGSGSGSGSGSGSGSGSSSGSGSGSSSGSGSGSGSGSTS
GSGKGTSSGSGSGSGSGSGSSSGSSSGSGSGSSLSNSTATTTGPVATYTGAATSLSAPLS
LLFAVAVAVFMQ

Enzyme Prediction     

No EC number prediction in EHY57616.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	55	589	2.3e-73	0.9804469273743017

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
259965	CuRO_3_Abr2_like	1.22e-82	430	595	2	164	The third cupredoxin domain of a group of fungal Laccases similar to Abr2 from Aspergillus fumigatus. Abr2 is involved in conidial pigment biosynthesis in Aspergillus fumigatus. Laccase is a blue multi-copper enzyme that catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. Laccase has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism in fungi and plants. Like other related multicopper oxidases (MCOs), laccase is composed of three cupredoxin domains that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 3 of 3-domain MCOs contains the Type 1 (T1) copper binding site and part the trinuclear copper binding site, which is located at the interface of domains 1 and 3.
259919	CuRO_1_Abr2_like	7.65e-62	40	156	1	117	The first cupredoxin domain of a group of fungal Laccases similar to Abr2 from Aspergillus fumigatus. Abr2 is involved in conidial pigment biosynthesis in Aspergillus fumigatus. Laccase is a blue multi-copper enzyme that catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. Laccase has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism in fungi and plants. Like other related multicopper oxidases (MCOs), laccase is composed of three cupredoxin domains that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 1 of 3-domain MCOs contains part the trinuclear copper binding site, which is located at the interface of domains 1 and 3.
274555	ascorbase	2.55e-55	46	606	12	535	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
177843	PLN02191	2.29e-54	49	605	37	557	L-ascorbate oxidase
215324	PLN02604	1.39e-48	59	606	45	558	oxidoreductase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIW00656.1|AA1	2.29e-176	34	603	34	609
QRC97610.1|AA1	1.76e-173	38	603	40	611
UQC89926.1|AA1	2.38e-166	18	604	23	613
QBZ62892.1|AA1	6.81e-165	38	595	41	607
QBZ54343.1|AA1	3.05e-163	38	603	28	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5LM8_A	1.20e-43	54	599	39	509	Crystal structure of a laccase-like multicopper oxidase McoG from from Aspergillus niger [Aspergillus niger]
5LWW_A	1.21e-43	54	599	40	510	Crystal structure of a laccase-like multicopper oxidase McoG from Aspergillus niger bound to zinc [Aspergillus niger]
5LWX_A	3.30e-43	54	599	67	537	Crystal structure of the H253D mutant of McoG from Aspergillus niger [Aspergillus niger]
1AOZ_A	1.41e-40	56	616	21	544	Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1AOZ_B Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1ASO_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASO_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASP_A X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASP_B X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASQ_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASQ_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo]
3V9E_A	1.67e-39	54	594	83	542	Structure of the L499M mutant of the laccase from B.aclada [Botrytis aclada]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0UHZ8|ELCG_PHANO	3.12e-174	38	603	40	611	Multicopper oxidase elcG OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) OX=321614 GN=elcG PE=1 SV=1
sp|A0A2G5I8N8|CTB12_CERBT	3.34e-159	38	603	48	621	Multicopper oxidase CTB12 OS=Cercospora beticola OX=122368 GN=CTB12 PE=3 SV=1
sp|I1RF62|GIP1_GIBZE	2.18e-132	44	607	31	601	Multicopper oxidase GIP1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GIP1 PE=1 SV=1
sp|E9RBR0|ABR2_ASPFU	3.32e-132	38	606	20	583	Laccase abr2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=abr2 PE=1 SV=1
sp|A0A1S7IUL2|MCE_TALPI	3.43e-126	40	603	28	589	Multicopper oxidase MCE OS=Talaromyces pinophilus OX=128442 GN=MCE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000230	0.999744	CS pos: 21-22. Pr: 0.9820

TMHMM  Annotations     

There is no transmembrane helices in EHY57616.1.