CAZyme Information: EHY57161.1

Basic Information

• Species: Exophiala dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala dermatitidis
• CAZyme ID: EHY57161.1
• CAZy Family: GH5
• CAZyme Description: GPI-anchored cell wall beta-1,3-endoglucanase EglC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433		43455.43	4.2652

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EdermatitidisNIHUT8656	9356	858893	71	9285

• Gene Location: location=JH226133:2463358-2464659(-)

Full Sequence      

MKSSILALLGGAATALAAVRGFNYASQGQDYDGFLSQFKTAASLAGADDFTSARLYTMIQ
EGTTNTPISAIKAAIDSKTTLLLGLWASEDEATFENEITALKSAISTYGSDFADLVVGIS
VGSEDLYRISPIGIAAGSGVGQTPDVLVKYIGKVRDAIKGTALSSTPVGHVDTWNVYVNE
TNAEVISNCDFLGLDEYPYYQTTDENSIDNAGNLFFEAYDKVAAVAGGKPIWVTEAGWPT
SGPKSNLAEASVENAETFWQTVACELEHRGVDFWWYILADAGASPSFGVSENGKPLYNLA
CNATSGFKNSTSSSTTSASGNSTATSTASGSHTSHASTNGTVTTKSGSGSATGTGSGSTS
TVIETASAGGSGSGSGSGSSSGSGSGSGSKASAGTGASATSTGATAPYTGAASKLEGSIA
GLAVVAGVAAFAL

Enzyme Prediction     

No EC number prediction in EHY57161.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	22	300	3.9e-18	0.9871382636655949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	6.90e-28	72	292	94	303	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.92e-06	171	301	157	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX54194.1|GH17	2.58e-103	6	314	7	324
QGA20137.1|GH17	2.12e-100	15	303	20	317
QRC96667.1|GH17	2.24e-100	2	301	4	316
CAP82907.1|GH17	1.08e-98	2	305	3	313
QQK48355.1|GH17	1.10e-97	3	314	4	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.06e-20	81	295	94	290	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUT0|EGLC_EMENI	2.90e-97	2	305	4	315	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1
sp|Q4WG16|EGLC_ASPFU	1.04e-95	5	305	6	314	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	1.17e-95	5	305	6	314	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	3.30e-95	3	313	4	322	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	3.71e-94	3	314	4	320	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.038067	0.961890	CS pos: 17-18. Pr: 0.9363

TMHMM  Annotations     

There is no transmembrane helices in EHY57161.1.