CAZyme Information: EHY56637.1

Basic Information

• Species: Exophiala dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala dermatitidis
• CAZyme ID: EHY56637.1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345	JH226133|CGC5	39936.51	9.7008

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EdermatitidisNIHUT8656	9356	858893	71	9285

• Gene Location: location=JH226133:1068136-1069173(+)

Full Sequence      

MRRSLLIFLLFTIVLVTLLLHSVSTLLSLLIEDASGDAIHRAELPEPNSTLLESRPQLIP
KIIHQTYINESIPAHWKPAQQSCIKLHPDYEYILWTDEKSVDFIAKEYPWFLPTFTGYRH
NIQRADAIRYFVLAHYGGIYIDLDDGCQRKLDPLLSYTAWLRRTVPTGISNDVMAAIPQH
PFFLRVIESLQGADRSWVLPYITIMASTGPLFLSVIWKKWMGEHSHLDQENWVGRVRVLM
PDEYNNHPWSFFKTYKGSSWHGKDAKFIFWMGKNWLFLTVLGFVLAGMVGMAIWWLYSRL
IVVGARRRAVGSPRITAFRMVSRVPLFGKWGAPKQSYELVTQRDA

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	75	156	2e-23	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.53e-76	1	290	7	310	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.33e-27	73	158	1	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS14035.1|GT32	1.61e-156	1	344	1	359
BCS02358.1|GT32	1.61e-156	1	344	1	359
EAA57874.1|GT32	1.98e-156	1	308	1	303
AAP47108.1|GT32	1.98e-156	1	308	1	303
BCR89010.1|GT32	6.29e-156	1	308	1	303

PDB Hits     

EHY56637.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	4.91e-100	1	284	1	283	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	3.84e-98	1	284	1	275	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.01e-83	58	285	81	306	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	1.13e-82	48	283	46	277	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	7.87e-58	59	312	64	309	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.269436	0.730543	CS pos: 26-27. Pr: 0.3913

TMHMM  Annotations     

Start	End
5	27
275	297