CAZyme Information: EHY55917.1

Basic Information

• Species: Exophiala dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala dermatitidis
• CAZyme ID: EHY55917.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403		44304.79	4.6219

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EdermatitidisNIHUT8656	9356	858893	71	9285

• Gene Location: location=JH226132:2854268-2855723(-)

Full Sequence      

MKTPTASLATAIYLAHLISSVSVAGFVVPRHSSSSSSSSSSNRDHSSPSGTPWSASNFDS
LITFGDSYTDESRLGWFINHNGSAPPAGTLLPESNSTAGGGRTWPRYVVQYTGSTDNNDA
WTPQMTLYNYAVSGAACSNEITPRWFSTINAPFPSVLDYEIPAFRADLSATRFNSTPPEP
YFTPSLTASSAVYALWIGTNDLGVWAFLTDSQIPGKVLSDYTSCIYEVFDNLYASGGRRF
VLMNTAPLELAPLYANETLHGVGDNQYWPDKPSNLTQIAETMHEYTSTVNTVFRYQTPFD
IAKNRYPGAEFALFDVHGLILDIYNNPTTYLNGTGVGPGSESVWGYENHCNVNQTVCVKR
ENGTNPDAFLWFDELHPSEQTDRIIARHFVDVLNGNSTYATYY

Enzyme Prediction     

No EC number prediction in EHY55917.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	61	389	6.4e-67	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	8.11e-44	60	392	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	3.10e-15	189	391	128	313	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	2.58e-10	54	386	25	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	8.92e-06	58	393	1	281	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	3.15e-05	61	389	1	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW44554.1|CE16	6.28e-113	53	403	26	353
QRD84022.1|CE16	6.28e-113	53	403	26	353
BAE62044.1|CE16	6.28e-113	53	403	26	353
QMW32524.1|CE16	6.28e-113	53	403	26	353
UDD57534.1|CE16	6.28e-113	53	403	26	353

PDB Hits     

EHY55917.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	2.15e-96	52	403	21	345	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1
sp|Q9FHQ1|GDL80_ARATH	7.94e-09	111	398	91	347	GDSL esterase/lipase At5g37690 OS=Arabidopsis thaliana OX=3702 GN=At5g37690 PE=2 SV=1
sp|Q0WUV7|EXL4_ARATH	1.33e-06	57	395	25	341	GDSL esterase/lipase EXL4 OS=Arabidopsis thaliana OX=3702 GN=EXL4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.644302	0.355707

TMHMM  Annotations     

Start	End
7	29