CAZyme Information: EHY55802.1

Basic Information

• Species: Exophiala dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala dermatitidis
• CAZyme ID: EHY55802.1
• CAZy Family: GH3
• CAZyme Description: mannan polymerase II complex ANP1 subunit

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405	JH226132|CGC2	46290.91	7.1135

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EdermatitidisNIHUT8656	9356	858893	71	9285

• Gene Location: location=JH226132:2572276-2573754(-)

Full Sequence      

MLLPKGGVNWKSAKARLPPWRAILMFLTRTRFLVVVALTGLIVLLWRGISVSTREMSNYY
CFGPSKPPTQMSINEMVAWNQHLQTPVLFNHHEPLEVNSSTIQHIDLNPIVSTPRAVSNR
ERVLILTPLRDAAPYLIKYFDLLSELTYPHELIDLAFLVGDSTDDTLAVLASELNRIQSR
TDKIPFHSATIVQKDFGMTMNMDVESRHKLAAQGPRRKAMGRARNYLLSAALKPEHSWVY
WRDVDIVDSPKKIIEDFVAHDRDILVPNIWFHRYENGRDIEGRFDYNSWIESDKGRRLTS
TLDKDVVLAEGYKEYDTGRTYMARMGDWRNNKDEEIELDGIGGVNILVKADVHRSGINFP
CYAFENQAETEGFAKMAKRAGYQVVGLPNYVVWHIDTEEKPGNAG

Enzyme Prediction     

No EC number prediction in EHY55802.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	99	362	5.2e-109	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	2.18e-162	101	363	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD70999.1|GT62	1.15e-250	1	404	1	404
UQC85603.1|GT62	1.34e-249	1	404	1	404
QKX56390.1|GT62	1.76e-242	1	405	1	406
QBZ58943.1|GT62	5.53e-242	1	404	1	404
BAE59398.1|GT62	9.81e-242	1	405	1	405

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	2.64e-66	102	398	6	303	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74745|ANP1_SCHPO	1.03e-92	99	395	74	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P32629|ANP1_YEAST	1.38e-92	88	395	48	355	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|P23642|VAN1_YEAST	2.02e-80	100	395	170	512	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	5.62e-76	96	395	70	419	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P39107|MNN9_YEAST	1.84e-67	54	398	56	393	Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN9 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999993	0.000005

TMHMM  Annotations     

Start	End
32	49