CAZyme Information: EHY55582.1

Basic Information

• Species: Exophiala dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala dermatitidis
• CAZyme ID: EHY55582.1
• CAZy Family: GH27
• CAZyme Description: chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341		38017.74	4.6626

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EdermatitidisNIHUT8656	9356	858893	71	9285

• Gene Location: location=JH226132:2018069-2019094(+)

Full Sequence      

MRSEVFNEDNPFEWPLFTSVDAVRSEFAPGAAIMVAIGGWGDTEGFSVAAATDASRKRFA
ANVKAMVDAKGADGVDVDWEYPGGNGDDYKQVPNSAKAWEVDAFPKLLAEIRSALGPDKL
ISAAVPGLRRDMIAFTADTVPQIDQSLDFWNIMTYDLMNRRDNVTKHHAGVVEALDAIDA
YLERGVPVDKANLGFPFYVKWFKTDPKSNCDVHPLGCQTVLMEDPVTGADLGQAGAFCWA
DDVPPELATSYARAMKYGMYDLERGGHYYWDADEGIFWSWDTPESIARKITVMDTRKLSS
VFAWGLGEDSRDWRHLRALTAMYQNHTRLEVHVRKKGKDEL

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	28	314	4.2e-52	0.777027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	1.97e-66	3	309	38	307	Glycosyl hydrolases family 18.
214753	Glyco_18	1.92e-54	28	309	64	334	Glyco_18 domain.
119365	GH18_chitinase	3.78e-47	33	309	87	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
225862	ChiA	3.95e-36	28	309	124	423	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	7.22e-36	33	306	73	338	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX61480.1|GH18	2.44e-153	1	325	50	375
CAE7199879.1|GH18	1.75e-150	1	319	59	379
CBY01085.1|GH18	1.31e-148	1	318	31	349
EAA66094.1|GH18	2.29e-148	1	321	29	349
AEO67798.1|GH18	3.41e-140	1	319	66	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BT9_A	5.90e-22	29	311	156	450	Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
6TSB_AAA	3.08e-20	29	198	89	261	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	3.68e-20	29	198	108	280	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
1WNO_A	4.62e-19	33	309	92	351	Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus],1WNO_B Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus]
6KXN_A	5.23e-19	34	311	79	359	Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q873X9|CHIB1_ASPFM	3.02e-18	33	309	130	389	Endochitinase B1 OS=Neosartorya fumigata OX=746128 GN=chiB1 PE=1 SV=1
sp|E9QRF2|CHIB1_ASPFU	3.02e-18	33	309	130	389	Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiB1 PE=3 SV=1
sp|P11797|CHIB_SERMA	1.74e-17	29	319	86	418	Chitinase B OS=Serratia marcescens OX=615 GN=chiB PE=1 SV=1
sp|A6N6J0|CHI46_TRIHA	1.11e-16	30	311	122	392	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
sp|P48827|CHI42_TRIHA	6.47e-16	30	311	121	385	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EHY55582.1.