CAZyme Information: EHY55088.1

Basic Information

• Species: Exophiala dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala dermatitidis
• CAZyme ID: EHY55088.1
• CAZy Family: GH16
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793		87779.09	5.5801

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EdermatitidisNIHUT8656	9356	858893	71	9285

• Gene Location: location=JH226132:680185-682566(-)

Full Sequence      

MGENNSNQDAVPSPSPSPTFTYQDAVQEIRSGQPIAQVVDRLVSEMTDSERLSLLDGDED
FWTGFRNLFYDRFNRVPYIFGAIPRLGIPGIHFTDGPRGVVMGASTAFPVTMARGATWDT
SLEERVGHAIGLEAKAQGATFYSGVCINLPRHPAWGRSQEVYGEDPILLGEFGLALTRGV
QRHIMACVKHFALNSMENARFKVDVEVDEDVLHEVYLPHFRRVVEGGVASVMSSYNSVNG
EWAGQNKHLLTDILRNTWGFDGFVISDFIWGLRDAVASVKAGLDIETPFKQQRHLHLPRA
LGSGDLEWDQVNRICTRILRKQLQFHETLDKNKPDMDVVFSEEHRTLARYVAARSAVLLK
NEPVDGKPLLPIDPTKITKIALVGRLANIPNTGDRGSSHVWSPHVVTIYEGVKSAFSHAE
IILVEDTDINSPGAASKAASIADADLVLCIVGYTDKDEGEYAAPTLMKDPALRATFPPAT
TKEEIEVLHFLENAAPREKDINKSKSDDAWKAGAGGDRQSLRLRPQDVETIHAVSQANPR
TIVSVVCGGAVILDQEWKNKVPALMLSWYAGCEGGHGLMDVLTGKIPPSGRLPFSIPTHE
SHLPHFDIDAEKIKYDRWFGQALLDKLGVEAAYPLGFGLSYTTFQVDNLRFDLARLKSNR
NDIDADADANANGTDTETHRDADTLTVYATVKNTDAYPGRYIAQVYGCPCPNIADFPKRL
LLGFNHVDLDIAESKDIEVIASIRPLQQWRDGQYRLRCDKVEIELASFAGDPMALRDTCY
LQTHYGSRNGPHL

Enzyme Prediction     

No EC number prediction in EHY55088.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	82	287	5.2e-62	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.73e-60	82	416	54	387	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	9.66e-60	85	749	101	733	beta-glucosidase BglX.
178629	PLN03080	8.36e-51	1	740	17	741	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.01e-39	85	320	63	315	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	2.69e-39	356	641	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE55411.1|GH3	4.96e-316	20	771	7	715
UCK59088.1|GH3	2.02e-315	20	771	7	715
QRD87369.1|GH3	4.06e-315	20	771	7	715
AGC95327.1|GH3	2.05e-310	20	776	7	720
QKD58937.1|GH3	2.34e-308	21	781	25	751

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	8.99e-75	39	737	5	623	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	8.50e-73	39	767	4	700	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.12e-71	39	767	4	700	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	2.60e-66	87	775	36	658	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
5XXL_A	9.63e-59	85	782	81	754	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14002|BGLB_ACET2	4.63e-74	39	737	5	623	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
sp|A7LXS8|BGH3A_BACO1	1.93e-72	84	753	74	716	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
sp|Q5BB53|BGLI_EMENI	5.01e-69	39	751	6	799	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|P27034|BGLS_RHIRD	3.14e-67	38	644	1	696	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|F6C6C1|APY_BIFBA	2.55e-64	87	771	36	663	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999961	0.000064

TMHMM  Annotations     

There is no transmembrane helices in EHY55088.1.