CAZyme Information: EHY53602.1

Basic Information

• Species: Exophiala dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala dermatitidis
• CAZyme ID: EHY53602.1
• CAZy Family: GH12
• CAZyme Description: chitin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800	JH226131|CGC14	90095.95	8.6615

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EdermatitidisNIHUT8656	9356	858893	71	9285

• Gene Location: location=JH226131:795646-798222(+)

Full Sequence      

MPWNGLTSRLFKKHEGPLLPITEEKKEEIENNNAPQSVNTQHSIENEKYPRKDSRNDEGP
APDQVHGLPEIKITLASPEAEEPTEENTEYAAPADYEKELAKSAPYRKPAAFNNPFGDNV
HALPHAQTTNPRRASQWQAQRRTSSQPHLLQPAAQPIRNFSRPSFPSIDDKITWQPDPNR
YPADYRRRQSSWAQDKPRRPSEWGRKVSTISTLSTQSEYPEIVDPVDPARKLSPRNLVTQ
RILFLGIVIILNLGCLMAALFSHSGTWVFVFILVVKSKDVLSALVSPTGMLLRRIYHIFK
PPKEVPSKWILSLIPAYSESEEQIVKCIFSLRDNGVEPHRQVMCVVLDGKPRDVKSHYTE
LLCTIERPYVSFKHQLGALRIHAGFMKDVPVIIIEKKKNAGKKDSLILAHDLFNFPRNNM
PLYSELLRSEIWEHILPELTDQFPFEGFDMIFCTDADSVIHQGALASLTNALARKENSIA
ACGLVLVELEPGYEWSLWNMYQQFQYCFGQYVRRRAEHFWGKVTCLPGCITMIKCRPECA
GAIAKYAEAVTVMPVLHHQVQYLGTDRRLTYCLLSQNRKLTTLFVPEAVSETVAPQSLQH
YLSQRRRWGSNAYFNNYFYMTGEKMSPITRVAAFIEILRLSMVYYRFCNTILLVHHIIVG
IINHTFETARLAPLLAVSQTPLLWFIISVMIEPQLRCRAHKLAMGFCINKCVSSFISMTV
FWRVCRNVGSQVWGISGVTAASGAAAAGATAITAAAVPAVPVVPAVPAAAVGVAEPPTAV
IAPTKEDVVAPDLPRQQLNV

Enzyme Prediction     

No EC number prediction in EHY53602.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	396	615	1.9e-24	0.42314990512333966

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	9.63e-30	397	615	49	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
367353	Chitin_synth_2	2.66e-26	300	608	17	370	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
224136	BcsA	1.05e-11	263	693	8	360	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	5.18e-10	313	534	2	162	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
404520	Glyco_tranf_2_3	0.008	439	608	79	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK89963.1|GT2	2.42e-235	229	737	61	564
QKD60377.1|GT2	5.02e-233	229	737	184	687
CEI61656.1|GT2	5.25e-233	229	737	177	680
CCT74940.1|GT2	1.82e-232	229	737	179	682
QGJ01227.1|GT2	2.55e-232	229	737	179	682

PDB Hits     

EHY53602.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13395|CHS6_USTMA	1.13e-20	300	615	399	742	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|J9VNT4|CHS5_CRYNH	4.11e-20	304	615	1249	1588	Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
sp|J9VF17|CHS4_CRYNH	4.15e-19	300	615	498	841	Chitin synthase 4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS4 PE=2 SV=2
sp|Q4P333|CHS7_USTMA	5.46e-19	295	615	451	801	Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS7 PE=3 SV=1
sp|Q4P9K9|CHS8_USTMA	2.50e-18	308	615	1265	1600	Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS8 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000000

TMHMM  Annotations     

Start	End
242	264