CAZyme Information: EHY52443.1

Basic Information

• Species: Exophiala dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala dermatitidis
• CAZyme ID: EHY52443.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610		71192.25	6.7340

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EdermatitidisNIHUT8656	9356	858893	71	9285

• Gene Location: location=JH226130:1811995-1813907(-)

Full Sequence      

MNRSIHNKSHVHGMIRSRKFLVLIFLVSAIAFTTLLLRRSPRLEESAASLFHGHHAHEEN
QPLLPASSLLHPIHQLVSEAESEFQTVRARQSRSLRDAVAEYRRRYKMPPPPHFDKWFAF
AQKRGVELIDEYDTIYHQLQPFWALEPAVIRERTREAIGYDNALIAVTIRDGKVVTMDGG
GDRYQWHREATPVMLENFIKYLPDMDLAFNIHDEPRVVLQNDDLQHHVQVATDENIPRAY
GNQKLKNQWSPRPEDLGEGIRIKEYKTTRFNRYAHQATWSDSRMSCPLESAARYCLNDSC
PDNTAAYSGLPLGFVRNTTAFSDICNSPSMEKSFGFFDRPNAFDVTHDLFPIFSQSKISS
FQDILYPSPWYYMGRVKYEPERDMPWDEKAPTMYWRGSTTGGFSRDGGWRRQHRQRFLMK
IQPTNTVKILELDNSSSTETMWREKEISAAELSHYFDVKFTYIGQCDPGDCDAQREYFGT
VEPVNMFDAFGSKHLLDIDGNAFSGRYYAWLLSNSLVYKLAVFREWHDEWLKPWVHYVPV
GLIGDEYAETMRYFDQEESGKVEAKRLASQGRAWAQKVLRNEDLEVWYFRLLLEYGRLID
DNRYNIGFSL

Enzyme Prediction     

No EC number prediction in EHY52443.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	328	599	4e-79	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.61e-21	347	598	28	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.01e-12	351	598	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UCK57446.1|GT90	6.61e-257	70	610	84	619
BAE54850.1|GT90	2.66e-256	70	610	74	609
QGA13289.1|GT90	1.03e-253	17	608	4	588
BCR83603.1|GT90	2.41e-252	71	610	66	600
QKX56622.1|GT90	6.38e-248	16	610	299	888

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	7.43e-09	328	602	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	8.43e-08	351	599	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.55e-46	64	605	146	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	1.89e-08	328	602	123	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	4.41e-08	328	602	123	373	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	4.41e-08	328	602	123	373	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|Q16QY8|RUMI_AEDAE	6.04e-08	482	599	271	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999982	0.000037

TMHMM  Annotations     

Start	End
20	37