CAZyme Information: EHY52268.1

Basic Information

• Species: Exophiala dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala dermatitidis
• CAZyme ID: EHY52268.1
• CAZy Family: AA11
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838	JH226130|CGC8	94358.81	6.0231

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EdermatitidisNIHUT8656	9356	858893	71	9285

• Gene Location: location=JH226130:1330092-1332722(+)

Full Sequence      

MEDSPAQSSAASISGRSTRSVPSTFLEEVRHEIMVNHLYQQQCSHLWVSDGSGECEGVLV
RKSKGNYLACPQQLAHSQFAQVCAQLNLQVAMTVNSRVIKTFLAWAPDATDVPLMKGMRV
QILPTMADLPRARKHQFAAFIAADSLLVVWDDDPSNVVKRATTIESQLMELVWHTGEARD
DDEVQNEKDGGIQVTVDPESGETMSEHRSTNLMNTILVAFTLIIVVVLLGLAFRSLATEI
AVDGGYIRLAFLLLVPVQIFFTLFFAQVVVGCIAQCIGPVRQMQMNSKYYSAKCSPRLRT
PELPHVTVQCPVYKEGLASVIMPTVKSIKQAISTYELQGGTANMLINDDGLQAIDEEERK
ARIEFYQDHNIGWTARPPHNSEGFIRRGKFKKASNMNYGLMLSCKVEEKLQHIHRGPNWT
QNDESQAYEACLEQVLAETPRAWADGNIRVGDYILLIDSDTRVPADCLLDAVSEMEQSPN
VGIMQFASGVMQVVHTFFENGITFFTNLIYTAIEYTVANGDVAPFVGHNAILRWSAIQQV
SYVDEDGYEKFWSESHVSEDFDMSLRLQCDGYIIRLASWAHGGFKEGVSLTVYDELARWE
KYAYGCNELLFNPMRKWIYKGPFTPLFRRFLFSNIRFTSKITIISYIGTYYAIGAAWIMT
LANYFAIGWFNGYLDKYYIDSWKVWFSIVIVFNGLGNVSLAVMRYRIGQKSFLPALLENF
KWIVMLSIFLGGLSLHVSQALLAHMFEIDMTWGATSKEAEFSNFFIEVPKVIRKFKFSIA
FALIGIVAMIVLATNPGGFIPYDWLIKDFIAILPMSTVTASHLLLPIVLNPALMTFSW

Enzyme Prediction     

No EC number prediction in EHY52268.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	453	665	3.4e-53	0.9847715736040609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	7.33e-50	453	667	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.58e-12	451	745	138	422	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	2.28e-11	311	560	4	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133029	GT_2_like_c	1.28e-07	451	581	75	161	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
224137	GT2	7.20e-07	450	669	84	283	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO64878.1|GT0	0.0	12	838	69	892
QUC18054.1|GT0	0.0	7	838	63	893
QLI69301.1|GT0	0.0	12	838	66	894
UNI13811.1|GT0	0.0	12	838	67	891
QBZ66243.1|GT0	0.0	11	838	77	902

PDB Hits     

EHY52268.1 has no PDB hit.

Swiss-Prot Hits     

EHY52268.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

Start	End
215	237
249	271
650	672
685	707
722	744
778	800
810	832