CAZyme Information: EHY51943.1

Basic Information

• Species: Exophiala dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala dermatitidis
• CAZyme ID: EHY51943.1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	JH226130|CGC6	43790.54	7.5710

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EdermatitidisNIHUT8656	9356	858893	71	9285

• Gene Location: location=JH226130:459564-460762(-)

Full Sequence      

MDSPTWSRNINPLHQLYGTRRTVRWVVFLVLAALATLYITGQSYTPLVSTTTAFRPSKNR
AKYLSPEKLMERPISKDLQTIPRLFHQSWSAIKLPAKFERWSDSCRRAHPNWEWVLWTDE
DNENLVKKHFPWLLQTYQDLPGAIYKADLARNLYMYMYGGVYADLDVECLRPSDEIFNEY
NVSTVSHSQPRPVSTHDLQKSGRKAFFGRMGTDINEANSIPNAWMASTPGHPFFLLVIEN
VVKGLQDGSRNGQAPESVTGPARLFEMVNEYHIAEGLYAGEKLDQHVAKNPTAKHFTPRK
GLKHSVEVLPFYYIYPYSWLRDGEAFRDVCWVSRVTFDAETCKLLLATDRWPSYTITYWS
HSWAESGHDEGSLRRLEDD

Enzyme Prediction     

No EC number prediction in EHY51943.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	99	179	5.8e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.32e-26	28	242	37	215	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.09e-18	99	182	2	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO66576.1|GT32	3.68e-101	59	376	76	410
QLI72987.1|GT32	5.36e-88	61	376	50	358
ANH56535.1|GT32	2.80e-78	57	362	80	362
UKZ71055.1|GT32	3.28e-75	61	379	77	373
BCS29894.1|GT32	6.95e-66	65	363	72	380

PDB Hits     

EHY51943.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	2.79e-22	77	243	60	201	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	2.69e-20	75	241	51	188	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.82e-19	81	243	82	215	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	6.80e-17	79	271	60	223	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	7.84e-16	67	241	37	186	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000011	0.000003

TMHMM  Annotations     

Start	End
23	45