CAZyme Information: EGE00178.1

Basic Information

• Species: Trichophyton tonsurans
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton tonsurans
• CAZyme ID: EGE00178.1
• CAZy Family: GT59|GT59
• CAZyme Description: cell wall glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	GG698533|CGC1	28321.63	6.3371

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TtonsuransCBS112818	8625	647933	104	8521

• Gene Location: location=GG698533:41964-42827(+)

Full Sequence      

MKSSFAVDSCVPMPACKSKTYNWDDLSSVAPNTKYLGDAGKADWVSSGEPKSAGGNLLLT
MAPSTVGTLLGHNHYMWYGKATAKLKTSRGRGVVTAFILMSDAKDEIDFEFIGADLSTAQ
TNYYYQGITDYTHGKNQSLSNTFEEYHIYEIDWKPEKITWSIDGQVIRTLDRDSTMNETT
NQYNYPSTPARVQLSLWPAGLSTNGEGTIAWAGGLVDWKSEDIQKNGYYYAILTLSPSSA
MTLQRAQSSSKPTLHR

Enzyme Prediction     

No EC number prediction in EGE00178.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	48	217	6.2e-78	0.9770114942528736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	1.96e-87	33	233	1	194	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	3.91e-53	55	213	11	168	Glycosyl hydrolases family 16.
225182	BglS	7.21e-21	77	214	117	253	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185684	GH16_lichenase	1.16e-19	73	213	63	193	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185683	Glyco_hydrolase_16	1.11e-17	78	218	67	206	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS56628.1|CBM18|GH16_19	1.65e-110	2	234	58	291
QSS71477.1|CBM18|GH16_19	6.86e-110	2	234	58	291
QSS61834.1|CBM18|GH16_19	2.48e-107	2	227	58	284
BAE62875.1|CBM18|GH16_19	1.87e-105	4	231	59	287
QRD84694.1|CBM18|GH16_19	1.87e-105	4	231	59	287

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	2.92e-35	9	220	10	209	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
3O5S_A	2.58e-16	78	213	96	218	Crystal Structure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
1GBG_A	8.77e-16	78	213	72	194	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]
3D6E_A	1.84e-15	78	213	59	181	Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis],3D6E_B Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis]
1CPN_A	5.54e-15	78	213	14	136	NATIVE-LIKE IN VIVO FOLDING OF A CIRCULARLY PERMUTED JELLYROLL PROTEIN SHOWN BY CRYSTAL STRUCTURE ANALYSIS [Paenibacillus macerans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WI46|CRF2_ASPFU	2.60e-109	4	231	61	291	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|Q5AJC0|UTR2_CANAL	1.29e-79	1	231	60	293	Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTR2 PE=1 SV=1
sp|P32623|CRH2_YEAST	2.96e-77	1	233	58	293	Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTR2 PE=1 SV=3
sp|Q05790|CRR1_YEAST	3.35e-54	51	231	162	344	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1
sp|Q75A41|CRR1_ASHGO	6.21e-54	56	227	175	348	Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=CRR1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000007

TMHMM  Annotations     

There is no transmembrane helices in EGE00178.1.