CAZyme Information: EGE00111.1

Basic Information

• Species: Trichophyton tonsurans
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton tonsurans
• CAZyme ID: EGE00111.1
• CAZy Family: GT57
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853	GG698531|CGC1	94383.39	6.4328

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TtonsuransCBS112818	8625	647933	104	8521

• Gene Location: location=GG698531:138800-141419(+)

Full Sequence      

MSEEEEIRRSLGQLFIVGFDSLTASEDIKALIKAPFYIGNIILFRRNVYDAEQLITLTNE
LQQTARDAGHARPLFIAIDQENGWVSQIKPPIAAQLPGSMALGATGNVEVATITGKATGE
LLDALGINMNYAPVCDVNSEPSNPVIGVRSPGDDGVTVGRIASAFAKGLREKKIVPCAKH
FPGHGATTIDSHYGLPIVGKSIEELEACELIPFRRVTAENIESVMTSHIVLPALEESNLP
MTLSKSCVDFLRERLQYDGLLVSDCLEMEAIREYYGTEKGAAMAIAAGVDCAMVCHRLKV
QVGAYNEVYHALKRGDITMEGVAKSVARVTALKDKFISWQSVFRERKPELLSGLRLEHEG
VATRIYMRSATLVRDTQNILPINPGEKVVYAYISLVGENTAVPHTLPDTQSKFWDVIKLF
HSSTIECPVLQDIILEDDEMTKAKISEADAVILVTKDANMSADQVELTRLIEGLSKKLIV
VAIGGPYDFLQDEDLVKTYLTIYEPTVSAFRPAVRIIFGDMKSKGKLPVSAKPCQIPIEP
FNADRDLAKVVEIWHRLLPRYAVPSATLSHVLSRPNGNHFVTRVEDEVAGFVATYTNEDR
PTAFIPVVLVDSGHQGKGVGTALVEHARRYLRNTYATSSVTIGSSFPRFWPGVPMDISKQ
AQEFFIHRGFCPERRPSARDYTADLLSYKAPKGVLERAEKAGITYAPWRKEQYEECMEKQ
RKLFGKDAVWMGAYEGLAQTGQYNQVLVATDSSTGEQIGWTLMQELGIGMTRELAMQPLV
GIKSGQIGCVGVVPEARNKGVGLALITHAALDLKRRGMEHVFVDWSNHVNWYERAGFKVW
GEYRTMVLHELAR

Enzyme Prediction     

EC	3.2.1.52:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	71	294	7e-55	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.35e-77	7	391	3	359	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.11e-70	7	332	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	2.12e-44	16	332	8	305	beta-hexosaminidase; Provisional
404402	Acetyltransf_7	6.78e-08	575	670	1	81	Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.
395465	Acetyltransf_1	9.77e-08	574	670	30	116	Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM13647.1|GH3	0.0	3	850	2	848
QQK41162.1|GH3	5.00e-235	6	844	5	848
CAP94355.1|GH3	7.07e-235	6	844	5	848
QKX56918.1|GH3	1.55e-231	1	844	1	850
BCR85716.1|GH3	3.09e-231	6	848	5	854

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	1.64e-152	1	844	3	854	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	2.02e-87	7	528	13	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	5.01e-60	21	529	69	615	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.51e-59	21	529	43	589	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.67e-59	21	529	73	619	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	2.58e-59	21	529	69	615	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	1.33e-52	23	530	50	595	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|L7N6B0|LPQI_MYCTU	2.50e-38	8	333	62	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
sp|A0A0H3M1P5|LPQI_MYCBP	6.23e-38	8	333	62	380	Beta-hexosaminidase LpqI OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lpqI PE=3 SV=1
sp|Q5FA94|NAGZ_NEIG1	1.76e-34	22	297	20	291	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=nagZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EGE00111.1.