CAZyme Information: EGD99881.1

Basic Information

• Species: Trichophyton tonsurans
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton tonsurans
• CAZyme ID: EGD99881.1
• CAZy Family: GT39
• CAZyme Description: long chain fatty alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
749		79962.01	8.1542

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TtonsuransCBS112818	8625	647933	104	8521

• Gene Location: location=GG698528:8581-10891(-)

Full Sequence      

MALTVQASPLPPAPRPEDIFSPAQWETLLAVADTVIPSIGCTGTADSSTTHLVSQPQFDA
LVSSLRPAAVEDESEAARAAVQFLGESASSIPGFKESMCRTLALHVHQEGLRGIKTILAG
LNNFAVSFALTGSRTPFQHQPYHVRRQILSSWRSSYLPPLRAAHRALVALTKKSWVGSSP
SLPLVLGFPNVPVHGATSESFPYSFLQFPAGDGPEIIETDVVIVGSGCGAGVAAKNLAEA
GHRVIVVEKSYFFPNDHYPMSGCEGAFHLFSNGGAELSDDGSIGVVSGSTWGGGGTINWS
ASLQTQSMVREEWANAGLPLFTSSAYQTSLDRVCDYMGVSADFIQQNHGNSVLMEGARKL
GYSAKAVPQNTGHQKHACGYCALGCAAGIKQGPAVTFLADAARAGATFIEGFKAEKVLFG
RKLVKGKRVAIGVRGTWTSRDASGATHGTPAITRKVVIKANKVVVSCGTLESPLLLLRSG
LKNPQIGRNLHLHPVIIMSAMFDHETRPWEGSILTSLVSDFENLDGRGHGSKIEAVVMLP
NFFLPLMAWDNGLDYKTFAANARRMAGFISLTRDRDTGRVYPDPNDGRCRIEYTPSAFDR
KHILEGIIGAAKIAYVSGAREIRSSSLAIPTFTRPETSSDAADEGVNNAAFQEWIKKLRT
GVPLPTEQSMFASAHQMGTCRMGISPKTSVVDPTGMVWGTSGLYVADASVFPSASGVNPM
ITNMAITDVTSRKLASTMSHDPEVIKSRL

Enzyme Prediction     

No EC number prediction in EGD99881.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	218	736	1.1e-56	0.9671532846715328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	5.46e-50	297	495	33	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	1.81e-33	220	727	9	526	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	4.17e-30	574	727	1	140	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	4.45e-08	675	713	473	510	choline dehydrogenase; Validated
274888	Rv0697	2.66e-07	219	722	1	474	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	1.50e-205	10	739	16	735
AEO59298.1|AA3_1|AA8|1.1.99.18	4.62e-10	220	739	250	787
BDD69329.1|AA3_2	8.06e-10	454	749	250	546
UJO12159.1|AA3_3	2.00e-09	220	726	17	577
QQK45533.1|AA3_2	4.23e-09	455	735	251	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	2.56e-10	461	744	263	541	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	2.56e-10	461	744	263	541	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	3.38e-10	461	744	263	541	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
7DVE_A	3.32e-07	665	746	434	516	Chain A, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum],7DVE_B Chain B, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum]
6F97_A	1.75e-06	458	728	257	521	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ8|FAO1_LOTJA	2.82e-83	217	741	235	747	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|B5WWZ9|FAO2_LOTJA	2.07e-82	217	738	237	746	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|O65709|FAO4A_ARATH	6.59e-82	217	726	222	710	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2
sp|Q9LW56|FAO3_ARATH	1.91e-81	217	739	231	741	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|Q9ZWB9|FAO1_ARATH	1.17e-76	217	738	244	752	Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana OX=3702 GN=FAO1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999303	0.000723

TMHMM  Annotations     

There is no transmembrane helices in EGD99881.1.