CAZyme Information: EGD99603.1

Basic Information

• Species: Trichophyton tonsurans
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton tonsurans
• CAZyme ID: EGD99603.1
• CAZy Family: GT32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
451		49726.35	6.6993

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TtonsuransCBS112818	8625	647933	104	8521

• Gene Location: location=GG698524:53164-54673(-)

Full Sequence      

MSTAWQRVLRALVVASIISIILIYSARQFGPAPAHTPIRDRPDDQHKPFQPPVPAPDQEP
PSLISHPPPVVPTLESSSTDAPRTKPPGTPAGEPTKTAAVTTPSSHPGHVNEAIPRIPSK
IWQTAKHANLSSEYTDMSNTWIVKNPTFRHELLTDESSDDYVRSRYPGSDILALYTRLKI
PILRADLLRYLILLAEGGIWADLDTTCEQPVSNWLPGEISSTNSTIKTGLVVGLEPDADH
GGKKVLTNAVLAAQPGSKHIKAVVDDVVHQLLEIAKQRGVGPEGITLEMISDVVEVTGRK
KMTAKIIESLSKTLNKEIEESDLVKNSGNEPQCLDDVMILPVPAFASYNNNPIPQGRVLV
MHHHAGTWKSAAEEARKNREKQIQEEADQLKKTADEAERKQKEEAEELKKEEDATKKAKE
DGEKLRKEQEAKKEAERKANDKTWGSVRAKS

Enzyme Prediction     

No EC number prediction in EGD99603.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	138	216	2e-18	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	9.20e-23	112	229	80	192	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.59e-15	139	218	9	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
173412	PTZ00121	4.47e-06	369	442	1308	1390	MAEBL; Provisional
173412	PTZ00121	2.08e-05	369	442	1450	1521	MAEBL; Provisional
173412	PTZ00121	3.61e-05	360	438	1597	1674	MAEBL; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK48128.1|GT32	8.68e-60	111	379	80	350
BCS14453.1|GT32	1.82e-59	112	384	93	366
CAK46331.1|GT32	3.18e-59	112	384	141	414
BCS02801.1|GT32	4.40e-59	112	384	127	400
QKX62870.1|GT32	9.10e-59	113	386	106	380

PDB Hits     

EGD99603.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	3.07e-21	117	369	142	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.39e-20	116	370	129	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	7.26e-17	118	369	100	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	6.71e-12	117	351	96	365	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.90e-08	117	236	62	181	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999924	0.000098

TMHMM  Annotations     

Start	End
7	26