CAZyme Information: EGD98527.1

Basic Information

• Species: Trichophyton tonsurans
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton tonsurans
• CAZyme ID: EGD98527.1
• CAZy Family: GT2
• CAZyme Description: endo-1,3-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862		93198.04	8.6900

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TtonsuransCBS112818	8625	647933	104	8521

• Gene Location: location=GG698512:46928-49972(-)

Full Sequence      

MKPYTTLPGVAVLVSLLTQSAHAAPFPSRADVVRTREQESAAKPQPIVYKHERGVTNQIQ
YSPPDPQGHPTVIPFPTYISYLTFNARPGAIHPPYPHLDISEASLKSGDSTCWYRNKPCE
GVPHIPIVKGFDSVEKRSPAPQRHPPAPTKATAGYQFANCTSTSNPGPTATSTVSGIPSQ
SSTPPATMAGQDIFQPIAKDPIPANIKSRDDHPVKATHIENPTGPISTNKFYANFFLGNQ
TSTTFTHPYTMIWAKGDRNASSFGMAISHVEPFQRATGEPNNKLPGNPVRYYINPVGIKS
IVLSASELKESTTMSVAKPQAFSAQAILRPRGGASESITFPLVQGMGFITAIYNNLQPAI
QSAVLFRKVEPAGSPQEGIFKYKITLEDGKNWLLYVTPENGSDPKLKLENNKLISGPTGF
KGVIQVAKNPSAEEGEGIYDKSAGSYATNIKISGSVGTDGTGTYKFSFEKAGKGGPLVMY
ALPHHVESFDDATKNTKKNMKLSTTTKGMATACVGDSWTMVEGNLPLSMDFAPWRPGPTS
QAALSESAKNAIKAVAGNELSQDMEPQTNLNSMYFSGKGLNKFAGAIYTVQELVGDTAAA
SGPLNSLKESFKRFVENRQQIPLVYDNVWKGVVSSGTYEKGDTGLDFGNTLYNDHHFHYG
YFILTAAIIGKLDPAWLDANKAYVNMLVRDSGNSVDNDEHFPFSRAFDWYHGHSWAKGLF
ESSDGKDQESTSEDTMYAYAIKMWGKTSGDKSMEARGNLMLGVLARTLNNYFLMKSDNVN
QPKNFIGNKVTGIAMFASGAAAPAENVTGGWKGVLYANLAIIDPEASWKYFAQPSLDLSS
IDGGASRIWYLAYAAGLGGGPK

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	211	794	2.8e-186	0.8295819935691319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	148	861	9	759	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	543	851	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	5.81e-158	212	536	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABH10633.1|GH81	0.0	188	862	1	719
UDD56325.1|GH81	8.25e-295	186	859	2	723
BCS18746.1|GH81	4.45e-293	189	860	169	885
BAE58039.1|GH81	2.37e-292	186	856	2	720
ABX90783.1|GH81	2.37e-292	186	856	2	720

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBZ_A	6.52e-82	171	855	16	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K3A_A	2.83e-81	186	855	1	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
4K35_A	1.32e-78	186	855	1	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.52e-23	558	782	325	545	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	4.76e-17	650	772	436	559	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	0.0	1	856	1	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	9.16e-151	192	861	2	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.51e-135	192	857	46	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	4.17e-131	192	857	401	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.43e-130	192	856	427	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000325	0.999648	CS pos: 23-24. Pr: 0.9755

TMHMM  Annotations     

There is no transmembrane helices in EGD98527.1.