CAZyme Information: EGD96393.1

Basic Information

• Species: Trichophyton tonsurans
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton tonsurans
• CAZyme ID: EGD96393.1
• CAZy Family: GH3
• CAZyme Description: dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418	GG698494|CGC2	47433.05	8.8501

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TtonsuransCBS112818	8625	647933	104	8521

• Gene Location: location=GG698494:68702-70117(+)

Full Sequence      

MSRLYTAVQDLLTNPKHSRWICPLLLTFDACLCAAIILKVPYTEIDWSTYMQHIHLFLSG
ERDYTAIKGSTGPLVYPAGHVYAYTALYNVTDEGRDVPFAQTLFAALYLIFLATVMACYR
AIHAPPYIYPLLVLSKRLHSIFMLRMFNDGLAAGFIWAAVYMMLKRQWYAGVLLWTLSVS
IKMTGLLAAPAIAVILTFAVGFGQALGMGVFFVLVQILLGLPFLLENPTGYMTRAFEFTR
QFLFKWTVNWRFIGEDVFLSRPFSVALLAVHISLLVTFLAYVWILPAKMDLGSLVQQTFR
GRNLQRNISNSYVATTMMTSVVIGLLCARSLHYQFYAYLVWTTPLILWKSGFHPVLVFIL
WAAQEWAWNVYPSTNVSSTMVVGCLALQVLGVFWGMQCEEQRLAQFKGETKDLIDNQN

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	23	378	1.8e-138	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	23	378	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.
227937	COG5650	0.003	149	285	219	356	Uncharacterized membrane protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS55330.1|GT58	3.72e-176	4	394	3	393
QSS72893.1|GT58	1.23e-174	4	394	3	393
QVM12997.1|GT58	8.96e-174	10	390	9	389
BCR98022.1|GT58	3.92e-165	8	392	7	391
BCS10476.1|GT58	3.92e-165	8	392	7	391

PDB Hits     

EGD96393.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U6A4|ALG3_ASPOR	1.86e-163	8	392	7	391	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	3.76e-162	7	392	14	399	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	1.15e-156	10	394	71	455	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	3.83e-155	8	392	7	391	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1
sp|A2RA94|ALG3_ASPNC	8.94e-146	8	392	7	387	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000005

TMHMM  Annotations     

Start	End
20	42
103	122
142	164
171	193
203	225
263	285
308	327
339	361
376	395