CAZyme Information: EGD95494.1

Basic Information

• Species: Trichophyton tonsurans
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton tonsurans
• CAZyme ID: EGD95494.1
• CAZy Family: GH18
• CAZyme Description: glyoxal oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852		92786.62	5.7670

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TtonsuransCBS112818	8625	647933	104	8521

• Gene Location: location=GG698488:254592-257281(-)

Full Sequence      

MKGILLALLVCVAEAHIIFKHAPLSCDPILPAFQGCLRGQRCSRHGQCESSHRPEDEIQP
PQVDATVEVVQRDSEIQYAPGKCRGGAGEGEAGIAVDCFMKHPSHLIDDNDVTQKAARPY
LRRPFWRPHFRPKPEVSITGTNRVKLPAATASATSTSTTQPQPPKPSSPPGNVTTDGTCG
SSHGDTVCGDSFYGPCCSPYGFCGNSTSHCGLGCQSGPCINGPALKPIAPLSYHPFKIPG
KFATVGRSGVPAMMAILMPNGKVVFADKIENYTELILPNGQFAYSSEYDPVTNEVVALEY
KTNAFCAGGTVLADGRALSVGGNGPLNFIDPTVKDGFKGIRYLERKFDDPKGEEGWIEPG
HTLSTARWYPSVQTMPDGKIFVASGSLNGLNPTNSDNNNPTYEILDREGYPHGDSIVMSI
LEKNQPYYMYPFLHLLKDGNLFVFVSKSAQIFNVETDTIVKTLPDLRGDFRTYPNTGGSV
MFPLSSANGWEPEIMICGGGAYPDINSPTDASCGRIKPLSENPTWDVESMPSGRVMVEGT
LLPDGTIIWLNGCSRGAQGFGIAKDPVYDPWIYNPRASNVERWAVGGSSTIARMYHSVAL
LLLDGTVMVAGSNPVEQPVLVPNPKDPKTAYVTEFRVEIYVPHYLSGKKADQRPVDVVLS
NRHLVANGGNFTIKFNIHKEAIELHVVLYQGGFVTHSLHMGHRMLYLDHTGWKAGEREQV
VEVNMPPDSNVAPPGSYVIYIVVDGVPSMGQFVMVENPMQHGDKPKGDKLNGKQKGIQGK
PDKHVDKPEDNKKIENGGGVPKNDTSKDDKMDKGKEKQDTNDGKDKGGGNEEKKDKEDDK
YEEDDDDMEDED

Enzyme Prediction     

No EC number prediction in EGD95494.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	239	769	1.2e-153	0.9715808170515098

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399910	Glyoxal_oxid_N	1.48e-47	253	499	1	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
401164	DUF1929	7.42e-28	668	755	9	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
199882	E_set_GO_C	2.26e-24	652	755	5	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
211316	ChtBD1_1	1.13e-14	178	217	1	39	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	7.01e-12	178	216	1	36	Chitin recognition protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS69861.1|AA5|CBM18	1.34e-274	174	756	46	628
QSS64055.1|AA5|CBM18	6.62e-270	174	756	46	628
QRC90698.1|AA5|CBM18	2.13e-262	167	755	243	826
CAD89674.1|AA5_1|CBM18	1.46e-257	167	755	71	656
CCD49084.1|AA5|CBM18	1.18e-256	167	755	232	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UNM_A	2.79e-17	334	755	228	614	Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans],4UNM_B Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans]
2WQ8_A	3.71e-16	244	755	186	659	Chain A, GALACTOSE OXIDASE [Fusarium graminearum]
2EIC_A	4.71e-16	244	755	164	637	Chain A, Galactose oxidase [Fusarium graminearum]
1T2X_A	6.21e-16	244	755	164	637	Glactose oxidase C383S mutant identified by directed evolution [Fusarium sp.]
1GOF_A	8.19e-16	244	755	164	637	NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOG_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOH_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],2EIE_A Chain A, Galactose oxidase [Fusarium graminearum],2JKX_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ1_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ3_A Chain A, Galactose Oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3HRQ2|GLOX_VITPS	2.11e-63	245	755	21	521	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	2.79e-62	247	755	104	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|D4AUF1|WSCD1_ARTBC	1.01e-52	260	765	440	914	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	3.71e-49	247	756	76	594	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1
sp|Q01772|GLOX_PHACH	5.62e-44	248	755	35	549	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000274	0.999687	CS pos: 15-16. Pr: 0.9606

TMHMM  Annotations     

There is no transmembrane helices in EGD95494.1.