CAZyme Information: EGD95430.1

Basic Information

• Species: Trichophyton tonsurans
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton tonsurans
• CAZyme ID: EGD95430.1
• CAZy Family: GH18
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:F2RVT1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306	GG698488|CGC3	33612.23	7.1585

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TtonsuransCBS112818	8625	647933	104	8521

• Gene Location: location=GG698488:92736-93656(+)

Full Sequence      

MERAMAKVLFLLFTLCALVSFLSATPPRWPGRSQYQHSSSGIVSSVGQGSGTRQPNALRV
MFVGDSMTQGKQGDWTWRYRMWQWFQAQGIAVTFVGPYTGTVEPDGPAPPLNKLEDTPKA
SSIKTSGGYAPGVSPDFDRHHFAVWGRSAAFDKDLIYDVVSAHPADMMLLMLGFNDLGWL
FSKPMDAVASLYGLINNARKANPNLKFAVANIPQRSFIGRGDLPVSTDEYNSILRLALPQ
WSTEQSPIHLVELQEHYSCGMSNCEAGYDGLHPNAQGEFQIAHAFTLTLINNFKIGSSPL
VIPSNP

Enzyme Prediction     

No EC number prediction in EGD95430.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	58	286	1.7e-48	0.979381443298969

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	6.52e-35	138	289	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	6.34e-09	62	277	1	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.17e-08	140	277	39	176	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	4.36e-05	159	277	44	156	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225353	TesA	4.12e-04	146	284	55	203	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39824.1|CE0	2.85e-111	56	305	137	383
BAE63679.1|CE0	3.96e-105	58	306	57	308
SCG40251.1|CE0	3.30e-86	54	306	332	591
UKZ09962.1|CE0	1.11e-82	58	305	512	764
BAE60780.1|CE0	7.10e-80	107	305	19	217

PDB Hits     

EGD95430.1 has no PDB hit.

Swiss-Prot Hits     

EGD95430.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000197	0.999767	CS pos: 24-25. Pr: 0.9778

TMHMM  Annotations     

Start	End
7	29