CAZyme Information: EGD95220.1

Basic Information

• Species: Trichophyton tonsurans
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton tonsurans
• CAZyme ID: EGD95220.1
• CAZy Family: GH17
• CAZyme Description: Lysozyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
192	GG698487|CGC1	20592.46	5.5858

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TtonsuransCBS112818	8625	647933	104	8521

• Gene Location: location=GG698487:19034-19670(-)

Full Sequence      

MHPATILLLAIPALAQPSGSSSKFKRDCIGPDVNDETIALIKHFEGFVPRPAPDPIGLPT
VGYGHLCRTKGCSEVPFPFPLTEETATELLMQDVKSPQQSITLSTTDQVVLNANQYGALV
SWAYNVGGSAAKKSSLISRLNQGQDVDAVIREELPLWNKAGGHVLSGLVRRRAAEVELAS
EHTDQPALPVDC

Enzyme Prediction     

No EC number prediction in EGD95220.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	33	175	4.8e-36	0.9927007299270073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381599	lyz_endolysin_autolysin	6.73e-53	38	178	2	134	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381619	endolysin_R21-like	2.35e-30	37	178	8	140	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381620	lyz_P1	3.19e-29	33	178	2	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
226295	RrrD	5.31e-27	33	178	7	146	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
395766	Phage_lysozyme	2.22e-13	59	173	2	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS63085.1|GH24	2.04e-74	1	189	1	187
UPL03217.1|GH24	3.25e-62	28	192	24	188
UNI14262.1|GH24	1.04e-55	5	192	5	187
QKX60131.1|GH24	2.14e-51	6	192	6	181
BCS18335.1|GH24	3.33e-51	1	192	1	184

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	1.60e-17	30	175	49	189	Chain A, Lysozyme [Acinetobacter baumannii]
2ANV_A	5.23e-12	33	172	4	138	Chain A, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]
7M5I_A	9.58e-12	41	178	17	152	Chain A, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]
6H9D_A	5.65e-11	38	178	11	145	Chain A, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]
3HDF_A	4.69e-08	29	178	1	134	Chain A, Lysozyme [Enterobacteria phage P21],3HDF_B Chain B, Lysozyme [Enterobacteria phage P21]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07540|ENLYS_BPPZA	4.50e-16	33	183	3	146	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
sp|P11187|ENLYS_BPPH2	6.25e-16	33	183	3	146	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
sp|Q37896|ENLYS_BPB03	6.11e-13	32	175	2	138	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
sp|P09963|ENLYS_BPP22	1.38e-11	33	172	4	138	Endolysin OS=Salmonella phage P22 OX=10754 GN=19 PE=1 SV=1
sp|O80292|ENLYS_BPPS1	1.41e-07	30	175	29	158	SAR-endolysin OS=Bacteriophage PS119 OX=83128 GN=19 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000312	0.999652	CS pos: 15-16. Pr: 0.9561

TMHMM  Annotations     

There is no transmembrane helices in EGD95220.1.