CAZyme Information: EGD92490.1

Basic Information

• Species: Trichophyton tonsurans
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton tonsurans
• CAZyme ID: EGD92490.1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		41512.13	8.7819

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TtonsuransCBS112818	8625	647933	104	8521

• Gene Location: location=GG698477:185045-186115(+)

Full Sequence      

MSLVGYLFGKRRLLRTLPFRLLDFVWNAPLLVSLVLLFLYTCASLIHSYNSLNLALSRNS
ISLDDLPQGYVKALEDAISKNQPTYNVTILQDNDATPIPRIIHRTYSTPEFPEIWKDAYN
SCQVLLPEYQHYFWTDEKARDFIEANFKWFLATYDGYRYGIQRVDALRYFLLWHYGGIYM
DMDIGCRRDIRPLLDFPAWVPRTWPYGVSNDLMASSPGHPLMIKAALSLHDHNRWYVSKY
ITVFFTTGPMFFSGIILSWFEILKTGAKDDIASFKGPHGLAILPSQLYDTTEYTFFSHFP
GSTWHGNDVAVLSWLYHYLWIFFLVAFALMIVSVVLGPTRRAKRRIPRFMMKQELV

Enzyme Prediction     

No EC number prediction in EGD92490.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	114	194	1.6e-23	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.06e-50	70	329	55	305	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.29e-19	112	195	1	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD88228.1|GT32	1.43e-120	21	354	18	350
QMW37845.1|GT32	1.43e-120	21	354	18	350
QMW25762.1|GT32	1.43e-120	21	354	18	350
BAE56144.1|GT32	2.03e-120	21	345	18	339
UCK58225.1|GT32	1.20e-113	52	345	23	315

PDB Hits     

EGD92490.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	5.72e-61	80	348	40	300	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	5.78e-57	94	313	47	260	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.64e-55	72	314	52	291	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	2.85e-54	84	346	45	307	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P38287|CSH1_YEAST	3.26e-49	98	308	62	263	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000013	0.000024

TMHMM  Annotations     

Start	End
24	46
241	263
314	336