CAZyme Information: EGD91281.2

Basic Information

• Species: Trichophyton rubrum
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton rubrum
• CAZyme ID: EGD91281.2
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		46093.78	8.9787

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TrubrumCBS118892	8713	559305	97	8616

• Gene Location: location=GG700657:375969-377296(+)

Full Sequence      

MRLSRYFYRRLRRLPVAMALVAILWSFAEVLWVEQALVYQLRSEPGSLGDEKIYITGIHW
NNEKILREAWIPALVELVQAIGRDNVFVSLHESGSWDDSKGQLRYLDAVLAQNNIPRRIL
LNDTTHLDEISKPPASSGWIETPTGQTELRRIPYLANLRNSVMEPLYELKEAGIVFDKVL
FLNDVVFNTLDIRRLLSTRGGRFAAACSLDFSKPPKFYDTFALRDSEGHDQLMQTWPYFR
SRVSRRAIKYSEPIPVKSCWNGAVAMDSSPFYQNPPLKFRGISDGLAKSHLEGSECCLIH
ADNPLSDNKGVWLNPNVRVGYNIPAYTAVNPEKMSWLSTSSILSGLWKNRILRWFTTPWF
TEYTVRKRLSQYQREGLGDTEAGSFCLINEMQVLVANGWAHR

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	52	304	3e-82	0.9916317991631799

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	8.98e-120	52	299	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89692.1|GT69	1.62e-212	1	402	1	403
QMW30798.1|GT69	1.62e-212	1	402	1	403
QMW42851.1|GT69	1.62e-212	1	402	1	403
UDD59634.1|GT69	1.62e-212	1	402	1	403
UJO13624.1|GT69	5.91e-166	11	401	12	405

PDB Hits     

EGD91281.2 has no PDB hit.

Swiss-Prot Hits     

EGD91281.2 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999700	0.000328

TMHMM  Annotations     

Start	End
13	32