CAZyme Information: EGD90582.2

Basic Information

• Species: Trichophyton rubrum
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton rubrum
• CAZyme ID: EGD90582.2
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
102		10964.55	5.0211

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TrubrumCBS118892	8713	559305	97	8616

• Gene Location: location=GG700655:770227-770535(+)

Full Sequence      

MADLVKQSVVQCPDSKILLVGYSQGAMVTHAAKLLTHEKISAIAVFGDPGRLIPFANIPP
EKTKEYCNEGDPVCLNGFNWDAHESYGVLADEAATFLIKASS

Enzyme Prediction     

No EC number prediction in EGD90582.2.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	2	99	3.3e-24	0.6243386243386243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.62e-29	1	100	65	172	Cutinase.
223477	YpfH	4.66e-04	13	100	97	175	Predicted esterase [General function prediction only].
396693	Abhydrolase_2	0.004	13	75	103	161	Phospholipase/Carboxylesterase. This family consists of both phospholipases and carboxylesterases with broad substrate specificity, and is structurally related to alpha/beta hydrolases pfam00561.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR89623.1|CE5	7.64e-29	1	101	175	276
QQK39777.1|CE5	6.31e-27	1	101	173	274
BAE58644.1|CE5	7.89e-27	1	101	107	208
CAP91879.1|CE5	1.40e-26	1	101	219	320
QRD85183.1|CE5	7.64e-26	1	101	224	325

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	7.62e-17	1	98	142	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	6.34e-10	4	98	91	193	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	2.96e-09	4	98	82	184	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
1CUH_A	3.89e-09	1	99	98	205	Chain A, CUTINASE [Fusarium vanettenii]
4OYY_A	4.46e-09	11	97	93	188	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	7.96e-23	1	101	122	221	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|Q8X1P1|CUTI_BLUHO	2.07e-17	4	98	135	233	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1
sp|Q8TGB8|CUTI_MONFR	1.23e-16	1	97	94	195	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	1.76e-16	1	101	95	200	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|A0A024SC78|CUTI1_HYPJR	3.62e-16	1	98	142	244	Cutinase OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=M419DRAFT_76732 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EGD90582.2.