CAZyme Information: EGD90104.2

Basic Information

• Species: Trichophyton rubrum
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton rubrum
• CAZyme ID: EGD90104.2
• CAZy Family: GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350		39589.12	9.3270

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TrubrumCBS118892	8713	559305	97	8616

• Gene Location: location=GG700654:959493-960624(+)

Full Sequence      

MQHIHLFLSGERDYMAIKGSTGPLVYPAGHVYAYTALHNMTDEGRDIPFAQMLFAALYII
FLAIVMACYRAVHAPPYIYPLLVLSKRLHSIFMLRMFNDGLAAGFIWAAMYMMLKRQWYA
GVLLWTLSVSIKMTGLLAAPAIAVILTFAVGFGQALGMGVFFVLIQILLGLPFLLENPTG
YMTRAFEFTRQFLFKWTVNWRFIGEDVFLSRSFSVALLAVHITLLVTFLAFVWIIPAKMD
LGSLVQQAFRGRNLQRSISNSYVATTMITSVVIGLLCARSLHYQFYAYLVWTSPLILWKS
GFHSVLLFILWAAQEWAWNVYPSTNVSSTMVVGCLAIQVLGVFWGMQCEE

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	1	328	9.1e-123	0.9175824175824175

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	1.90e-166	1	328	29	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS55330.1|GT58	9.19e-152	1	344	50	393
QSS72893.1|GT58	3.03e-150	1	344	50	393
QSS65569.1|GT58	1.12e-149	1	344	1	344
QVM12997.1|GT58	4.23e-147	1	340	50	389
BCR98022.1|GT58	1.90e-140	1	342	50	391

PDB Hits     

EGD90104.2 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U6A4|ALG3_ASPOR	2.56e-138	1	342	50	391	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	8.93e-138	1	342	58	399	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A2RA94|ALG3_ASPNC	1.83e-132	5	342	50	387	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	5.77e-131	1	350	112	464	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	8.43e-129	1	342	50	391	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999018	0.000978

TMHMM  Annotations     

Start	End
47	69
91	113
123	145
152	174
215	237
258	280
290	312
324	346