CAZyme Information: EGD90013.1

Basic Information

• Species: Trichophyton rubrum
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton rubrum
• CAZyme ID: EGD90013.1
• CAZy Family: GH55|GH55
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		48978.47	7.0793

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TrubrumCBS118892	8713	559305	97	8616

• Gene Location: location=GG700654:711172-712515(+)

Full Sequence      

MDAQTHQHPTSAARKYRRRTVAVSLVLALVLLWCQLRGYPSPFTAPASCQHHAANPGCQW
NHKRDANTLVLGAERCQSAFPGLFAEIDRAKQERAQRPISLAEIDSVVPKNGYIRAMIYD
QQLYVIAVNGTIYSREIATLHALHRAIVSSPDPLPNIEFVFNTDDKVDPVAQWGYARREQ
DTNLWLMPDFGYWSWPETKVGTMQEVQMGAEREEHTWAWPKKIPQLFWRGATMDLEVRER
LIQVTRDQPWADVKPITWRDNDSMQNDLRSMPEHCRFKYLAQTEGNSYSGRLKYLQSCNS
VVISHSLEWIQHQSPLMKSSGPDQNYVEVRRDWSDLPEKIEWLEGHEQDAKRIARNNIKT
FREQYLTPAAEVCYWRQLIRSWAEVSFEPEFFKEADGKKAWRGVPVESFLLMQRLEWDPY

Enzyme Prediction     

No EC number prediction in EGD90013.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	162	385	3.4e-29	0.948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	4.26e-26	110	390	35	328	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	1.23e-24	153	383	1	250	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ37094.1|GT0	8.02e-146	60	420	68	435
QLI69899.1|GT0	4.38e-103	37	411	71	448
USW51979.1|GT90	5.89e-99	44	417	56	454
UDD61446.1|GT0	1.51e-98	41	411	50	436
BCS13796.1|GT0	9.60e-98	40	411	49	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	3.62e-14	154	384	94	340	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	2.01e-10	154	385	128	378	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7ZVE6|PLGT2_DANRE	4.48e-14	154	385	226	465	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1
sp|G3V9D0|PGLT1_RAT	9.61e-14	154	384	122	368	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	2.30e-13	154	384	122	368	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q8BYB9|PGLT1_MOUSE	5.51e-13	140	384	116	368	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2
sp|Q5E9Q1|PGLT1_BOVIN	7.49e-12	154	384	122	368	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999845	0.000155

TMHMM  Annotations     

Start	End
21	39