CAZyme Information: EGD87717.1

Basic Information

• Species: Trichophyton rubrum
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton rubrum
• CAZyme ID: EGD87717.1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	GG700651|CGC1	41614.32	8.9752

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TrubrumCBS118892	8713	559305	97	8616

• Gene Location: location=GG700651:281151-282221(+)

Full Sequence      

MSLVGYLFGKRRLLRTLPFRLLDFVWNAPLLVSLVLLFLYTCASLIHSYNSLNIALSRNS
ISLDDLPQGYVKALEDAISKNQPTYNVTLLKDKDATPIPRIIHRTYSTPEFPEIWRDAYN
SCQVLLPEYQHYFWTDEKARDFIEANFKWFLATYDGYRYGIQRVDALRYFLLWHYGGIYM
DMDIGCRRDIRPLLDFPAWVPRTWPYGVSNDLMASSPGHPLMIKAALSLYDHNWWYVSKY
VTVFFTTGPMFFSGIILSWFEILKTGAKDDIASFKGPHGLAILPSQLYDTTEYTFFSHFP
GSTWHGNDVAVLSWLYHYLWIFFLVAFALMIVSVVLGPTRRAKRRMPRFMMKQELV

Enzyme Prediction     

No EC number prediction in EGD87717.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	114	194	2.3e-23	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.78e-50	70	329	55	305	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.01e-19	112	195	1	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD88228.1|GT32	1.16e-119	21	354	18	350
QMW37845.1|GT32	1.16e-119	21	354	18	350
QMW25762.1|GT32	1.16e-119	21	354	18	350
BAE56144.1|GT32	1.65e-119	21	345	18	339
UCK58225.1|GT32	2.76e-112	52	345	23	315

PDB Hits     

EGD87717.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	4.06e-61	80	344	40	300	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	8.82e-56	94	313	47	260	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	7.99e-54	72	314	52	291	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	1.12e-53	98	344	64	305	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P38287|CSH1_YEAST	1.26e-48	98	308	62	263	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999970	0.000024

TMHMM  Annotations     

Start	End
24	46
240	262
314	336