CAZyme Information: EGD87200.2

Basic Information

• Species: Trichophyton rubrum
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton rubrum
• CAZyme ID: EGD87200.2
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
631		70591.59	5.7657

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TrubrumCBS118892	8713	559305	97	8616

• Gene Location: location=GG700650:1915237-1917132(+)

Full Sequence      

MWELSPFSGHVAKYIRGLNRCEVCSTDVYLLNTIYIPYLPPYTTIRFLFLTMSIQDGSRF
DFIVVGGGTAGNIVAARLAESRNVRVLIVEAGIDDSIDNEDIRTPAMAMDLRGSKYDWGF
KTTMVKRDDYERIEKPNTRGKALGGSSCLNYFSWVPGSKGTFDMWEEYGGKEWTWDPLVP
YLRKSVTYHDDKGLFPPELKCIGAGGPIPISHAELLPEMKDFRERLVQAWKSTGEPVTED
IFNGEMRGLTHSVNTVYKGRRCGSFLALVGKPNITVLSGVFSKCLMVDCADRCTKGVTVI
NGCGQEMSFYATREVIVSQGVFETPKLLMLSGIGPAAELARHNIKLIVDSPHVGQHLLDH
PGVPFALRVKDSFSMDSQVLRSGRCQDEARDQYSRSQSGPMASPFLEMIGFPRIDSYLEK
SPEYCAAKAANGGRDPFCPYGQPHFELDFIPLFGSAFQWHFPHPRKGSYMTVMVDLVQPV
SEGGEVTLNSTDPLEQANINLNYFNNDLDIIAIREGIRYAYDVLKHGDGFKDIVEDEYPW
EMPLDDDEAMKRTVLDRSQTSFHPCGTARLSKCIEQGVVDPRLRVHGIKNLRVIDASVIP
VIPDCRIQNSVYMVAEKGADAIKCDHPDLYC

Enzyme Prediction     

No EC number prediction in EGD87200.2.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	59	623	4.9e-145	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.82e-85	60	627	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.73e-80	59	623	5	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	6.68e-39	479	617	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.08e-24	58	614	54	568	Protein HOTHEAD
366272	GMC_oxred_N	1.69e-15	139	361	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX59780.1|AA3_2	0.0	52	630	1	579
QLI67929.1|AA3_2	0.0	52	630	1	579
QKD59313.1|AA3_2	0.0	52	630	1	579
QGI68848.1|AA3_2	0.0	52	630	1	579
QGI99737.1|AA3_2	0.0	52	630	1	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	4.12e-304	56	630	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.18e-303	56	630	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	3.37e-303	56	630	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	2.81e-67	60	625	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.50e-66	60	625	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0B711|BETA_BURCM	2.58e-56	59	627	5	537	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) OX=339670 GN=betA PE=3 SV=1
sp|B1Z034|BETA_BURA4	2.58e-56	59	627	5	537	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) OX=398577 GN=betA PE=3 SV=1
sp|A9AMZ9|BETA_BURM1	3.57e-56	59	623	5	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1
sp|Q988C9|4PADH_RHILO	4.26e-55	60	622	7	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|A4JJG6|BETA_BURVG	9.09e-55	59	627	5	537	Oxygen-dependent choline dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) OX=269482 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999938	0.000077

TMHMM  Annotations     

There is no transmembrane helices in EGD87200.2.