CAZyme Information: EGD86926.1

Basic Information

• Species: Trichophyton rubrum
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton rubrum
• CAZyme ID: EGD86926.1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246		26869.54	6.2177

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TrubrumCBS118892	8713	559305	97	8616

• Gene Location: location=GG700650:1209712-1210631(-)

Full Sequence      

MSVPGVTATPVLSPTDITYGCRLDGYCHASILSMALGQLSYYSLSLPWPSSKFKRDCIGS
NVNDETIGLIKHFEGFVLRPAPDPIGLPTVGYGHLCRTKGCSEVSFPFFLTEETATELLI
QDVKSSQQSITLSTTDQVVFNANQSGALVSWAYTVGGATAKKSSLISRLNREQDVDAVIR
EELPLWNKAGRHVLPGQVRRRAAEVELASGHTDQPPLLVDCYNNPIGQEFCGCRSDFPLI
YIGYHV

Enzyme Prediction     

No EC number prediction in EGD86926.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	62	204	9.1e-31	0.9927007299270073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381599	lyz_endolysin_autolysin	3.63e-41	69	207	4	134	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381619	endolysin_R21-like	2.76e-24	69	207	11	140	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
226295	RrrD	6.38e-22	59	207	4	146	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
381620	lyz_P1	2.38e-18	62	207	2	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
395766	Phage_lysozyme	4.19e-09	88	202	2	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS63085.1|GH24	5.54e-58	55	217	26	186
UPL03217.1|GH24	4.97e-47	57	221	24	188
UNI14262.1|GH24	1.74e-44	57	221	23	187
UNI17711.1|GH24	5.10e-38	57	217	23	183
QLI64717.1|GH24	6.20e-38	62	207	112	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	6.42e-12	59	204	49	189	Chain A, Lysozyme [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07540|ENLYS_BPPZA	2.84e-11	62	212	3	146	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
sp|P11187|ENLYS_BPPH2	3.88e-11	62	212	3	146	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
sp|Q37896|ENLYS_BPB03	1.64e-07	61	204	2	138	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.960463	0.039554

TMHMM  Annotations     

There is no transmembrane helices in EGD86926.1.