CAZyme Information: EGD86462.1

Basic Information

• Species: Trichophyton rubrum
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton rubrum
• CAZyme ID: EGD86462.1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740	GG700650|CGC13	78706.18	5.1538

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TrubrumCBS118892	8713	559305	97	8616

• Gene Location: location=GG700650:13506-15887(+)

Full Sequence      

MLTNLSVVWAAFALSGALALPTWPSSVDELEDLMFLNTGYHARGFSAGVTPCSFSQQGPS
RVASAEWVRTAFHDMATGNSFTGVGGLDASIVFELGGKGGENIGAGFNTTLETYTPFFST
RSSMADLIALGVYTAVRSCGGPVVQIRAGRIDATARGSIGVPQPENSQGTFINQFTRMGF
NVSDMIAVTACGHTMGGVHASNFPQIVVPGSAPNDFQLFDSTVAFDEKVAADFVGGVAGN
PLTSTTAKRNQRDADTKVFTADRNVTIKTLADRATFRSTCARVLQKMIEVVPSGVNLTAP
IAPYEVKPGRLQLSLAGNGSTIAFTGEIRVRTTSRPVTSISKVELVYKDRTGGSSCGSCV
ISTEYKGTAEGFDDSFAFYGFEARFPVETAISKFNVRVVLSTGETVVYNNNESSYPVQDT
IMLQPRQSCVLGGEVPGNLVVVAAVRNNANTGSVKLSVTTKTPRSCCVTPALTTQSVPMS
PQTTVGPYTLYSGNLTLAAAYRSNAKFDVSLTSGGAVISDSFKNTADLGSTCAPFGSNDT
TMPDYTFDGCYTDTPESRALTSVAFVNQNMTVAACSGLCKGYQFFGLEYGTECYCGDSRS
NSSMQAPKSECNQPCGGESSETCGAGYRIAIYKDDKWVPITSPQIPGYNYTGCYSDSPSN
RTLSGSFTYNEKMTVELCASFCNGTKYFGVEYFSECYCGANMFPESTIQPESDCGFFCSG
NKTQHCGGSNRINIYTKLDM

Enzyme Prediction     

No EC number prediction in EGD86462.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	62	287	2.6e-22	0.8980392156862745

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	5.19e-146	23	289	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
396406	WSC	2.47e-25	549	625	2	80	WSC domain. This domain may be involved in carbohydrate binding.
173823	plant_peroxidase_like	2.00e-23	65	289	19	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
396406	WSC	1.02e-21	652	728	2	80	WSC domain. This domain may be involved in carbohydrate binding.
214616	WSC	1.10e-18	544	632	1	92	present in yeast cell wall integrity and stress response component proteins. Domain present in WSC proteins, polycystin and fungal exoglucanase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18666.1|AA5_1	1.25e-274	5	735	6	731
VBB76056.1|AA0	3.08e-189	21	735	27	795
QBZ57066.1|AA0	3.63e-188	21	739	24	803
QRW22025.1|AA2	2.04e-100	22	535	20	538
QRV94524.1|AA2	3.02e-98	22	535	21	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FWW_B	1.46e-10	611	738	55	181	Wnt modulator Kremen in complex with DKK1 (CRD2) and LRP6 (PE3PE4) [Homo sapiens]
7BZT_E	2.66e-10	611	738	64	190	Chain E, KRM1 [Homo sapiens],7BZU_E Chain E, KRM1 [Homo sapiens]
6SNW_E	2.70e-10	611	738	67	193	Chain E, Kremen protein 1 [Homo sapiens]
5FWS_A	3.06e-10	611	738	95	221	Wnt modulator Kremen crystal form I at 1.90A [Homo sapiens],5FWT_A Wnt modulator Kremen crystal form I at 2.10A [Homo sapiens],5FWU_A Wnt modulator Kremen crystal form II at 2.8A [Homo sapiens],5FWV_A Wnt modulator Kremen crystal form III at 3.2A [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	0.0	1	740	1	720	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|P84675|PFM_CHAGB	1.40e-37	546	735	18	219	Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=CHGG_05463 PE=1 SV=2
sp|D4AUF1|WSCD1_ARTBC	1.21e-25	545	740	63	291	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1
sp|Q0IIY2|WSCD1_XENTR	3.65e-19	546	735	138	329	WSC domain-containing protein 1 OS=Xenopus tropicalis OX=8364 GN=wscd1 PE=2 SV=1
sp|A2BGL3|WSCD2_DANRE	3.45e-18	549	735	139	328	WSC domain-containing protein 2 OS=Danio rerio OX=7955 GN=wscd2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999764	CS pos: 19-20. Pr: 0.9729

TMHMM  Annotations     

Start	End
5	27