CAZyme Information: EGD86461.2

Basic Information

• Species: Trichophyton rubrum
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton rubrum
• CAZyme ID: EGD86461.2
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842		94320.20	6.1095

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TrubrumCBS118892	8713	559305	97	8616

• Gene Location: location=GG700650:9078-12321(+)

Full Sequence      

MFWKRSKTDKQQQQQQSAAPSPPRQSGLSSAPESYSRPISHSGTQTPVGIDDDAKYKAII
KYLHARLATSKWCPPPSDPNSEYHGLLLRKSRGVYISEPDLVHPLLLGAVQKINVAVAFT
MATEITRIIFSILQTDQTELILPSGFQVQVVESLAEIACSPSSAIKKFQYVALVREERLL
LIWHDELEKILIHAEDVEEKLLAFICGTRISVIAPSQSPSYSLPHSSIGSPAASTRNFVP
LWNKEASGLANSPLGIPDEEAAKPIESLDRPLALTSSIFVGLGMCLIVVLLVGFGISNLM
LQSLVDGSWLRFTLVASLPIFMLFSVFFVILLYLTTNPTEHRIGTATIFVNDDGLAYLTE
EQREERISFYHDNNIGWVSRPKNNQDGYIRKGRFKKASNMNFALNVSNKVEDKLLEMLAE
TLETTEMIDASQEEAYYKLALQEVLGSDSRIKAAGDIRIGEAILIVDADTRVPVDCLLYG
AAEMFLSPEVAIIQHSTGVMQVVGDYFENGITFFTNLIYSSIRFAVGSGETAPFVGHNAF
LRWKAVQSVGKPDDGYVAYWSESHVSEDFDIALRLQIAGDIVRLASYHGDEFKEGVSLTI
YDELARWEKYAYGCNELVFNPIYTWIYKGPFTKLFMTFLWCNMQLSSKITILGYISSYYA
LASGFPLTILNYFLVGWFNGYLDKFYIESWKVLLSLIVVFSLLGNVTLAIIRSRLSEKSL
WSALVENFKWMPMMAIFFGGVSFHLSLALLSHMFSIKMEWGATAKEKVDSNFFKEIPKIF
KSFKWMYAVLIPLIGGMIYLGNFAPRGWEIKEVAAVVPMAVTLSLHALLPLLLNPSLMIF
NY

Enzyme Prediction     

No EC number prediction in EGD86461.2.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	463	674	1.1e-55	0.9847715736040609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	5.16e-54	463	675	2	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.03e-10	460	737	138	403	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.30e-09	460	568	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133034	Glucan_BSP_MdoH	4.84e-05	432	606	51	243	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
224137	GT2	2.96e-04	461	657	86	283	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18667.1|GT0	0.0	22	842	34	919
QRD03074.1|GT0	2.11e-301	50	842	3	858
CAE7220538.1|GT0	7.47e-299	34	842	44	907
CBX97842.1|GT0	8.83e-297	46	842	49	904
CAC28725.2|GT0	3.52e-279	42	842	132	1003

PDB Hits     

EGD86461.2 has no PDB hit.

Swiss-Prot Hits     

EGD86461.2 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

Start	End
278	297
312	334
617	639
654	676
689	711
731	750
783	805
815	837